1T1J


Conserved Protein Domain Family
DUF1937

?
pfam09152: DUF1937 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1937)
This domain is found in a set of hypothetical bacterial proteins. Their exact function has not, as yet, been described.
Statistics
?
PSSM-Id: 370325
View PSSM: pfam09152
Aligned: 5 rows
Threshold Bit Score: 148.453
Threshold Setting Gi: 123590051
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T1J_A         9 RKIFLACPYS--------HADAEVVEQRFRACNEVAATIVRAGHVVFSQVSMS----HPINLCLAeLDRAAIGRLWAPVD 76  Pseudomonas aer...
Q3IW66       104 RPVYLATPYTlraigpdgRWSRDQSEATMAEAAREVARLLEVGVTAISPVVLSaaalHATMFPRL-RIDPFAPVLWEDWC 182 Rhodobacter sph...
WP_012115639  11 GITYVSVPYTahl---------ygLSAAAYDADRHAAHLIKMGFIPFSPISHS----HPI--ARVgGIDPRSHEIWMAQN 75  Xanthobacter au...
Q4KJD5         2 RKIFLACPYS--------HSEPAVINERFLQCNQVAAQILEAGHAVFSQVSMS----HPINLCLAgKDNAAIGKLWAPVD 69  Pseudomonas pro...
Q3IVN8        48 RPVYLATPYSlravdregRWSADMSAAAMGDAGREIVRLQQVGVTAISPVALSgvavHATLYPRP-MLDPLDAVLWAEWC 126 Rhodobacter sph...
1T1J_A        77 AFYMDHLEELIVLDLPGWRDSAGIRREMEFFEAGGQRVSLWS 118 Pseudomonas aeruginosa
Q3IW66       183 RPILSVCAAVVVPEIRGWTQSTGIRHEVASALTAQVPVFIYG 224 Rhodobacter sphaeroides 2.4.1
WP_012115639  76 DAFMEACSAMVAVHIPGWEDSIGMKMEREAFARMGKPVVEME 117 Xanthobacter autotrophicus
Q4KJD5        70 ALYMAMMEELIVLDLPGWKDSGGIKREIEVFETSGRRVSLWS 111 Pseudomonas protegens Pf-5
Q3IVN8       127 RPILDTCSAVVVPDIRGWSRSLGIWHEVRAALARQTSVFVYA 168 Rhodobacter sphaeroides 2.4.1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap