1PVM


Conserved Protein Domain Family
DUF1936

?
pfam09151: DUF1936 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1936)
This domain is found in a set of hypothetical Archaeal proteins. Its exact function has not, as yet, been defined. It possesses a zinc ribbon fold.
Statistics
?
PSSM-Id: 401188
View PSSM: pfam09151
Aligned: 2 rows
Threshold Bit Score: 76.1329
Threshold Setting Gi: 42543314
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PVM_B   151 LCPKCGVGVLEPVYNEKGEIKVFRCSNPACDYEE 184 Thermoplasma acidophilum DSM 1728
EQB69115 143 ICPKCNSGKLEPVYNDNGEIKFFRCDREDCGYIE 176 Thermoplasmatales archaeon Gpl
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap