5HGR,5FCY


Conserved Protein Domain Family
Carot_N

?
pfam09150: Carot_N 
Click on image for an interactive view with Cn3D
Orange carotenoid protein, N-terminal
Members of this family adopt an alpha-helical structure consisting of two four-helix bundles. They are predominantly found in prokaryotic orange carotenoid protein, and carotenoid binding proteins.
Statistics
?
PSSM-Id: 401187
View PSSM: pfam09150
Aligned: 53 rows
Threshold Bit Score: 174.688
Threshold Setting Gi: 81711392
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HGR_B             16 LQADAVPALTARFNQLSAEDQLAWTWFAFLEMGKTITVAAPGAASMQFAEGILKQIKEMTF-EEQTQVMCDLANHTDTPI 94  Nostoc sp....
jgi:Cyan7822_0704  11 ILSKETQAIFEEYNQLNTDDKLALLYYIYEKMGDSITPAGTNAINVDFLSSLIEDFLQLSD-NEQLEIMRDIVNAKDSEY 89  Gloeothece...
jgi:Osc7112_1512   11 SLSNDTQNIVQAINGLGTDEKLALLYFVYEKMGDSITPAAPAAAEPQLAPVLLDDFYKLSH-DEQLNIMRGIVNRDDTPY 89  Oscillator...
WP_015150138       11 TRSQDTQNIVNEFEKLSTDDQLAVLYWIYEKMGDSITPAAPGAAEPNIAPMLMDDYYKLSD-DEQLQIMRDIVERKDTVY 89  Oscillator...
jgi:Cylst_3414     12 VQGQETQQVVADFNNLDTDAKLAWLYFVYEKMGDSVTPAAPGAAEPELAPLLVEDYLELSD-EQQLEIMRDIVNRKDTEY 90  Cylindrosp...
jgi:Anacy_2740     13 AQSQKTQNLVERFNALDTDAKLAWLYFVYEKMGETITPAAPSAAEPELAPMLVGDYLQLSD-EEQLEIMRDIINCTDTVY 91  Anabaena c...
jgi:Cal7507_2842   12 SLSNETQKVVEAFNALDTDAKLAWLYFVYEKMGGSITPAAPTAADPELAPILLRDYLQLSS-KQQLDIMREIINNEDTDY 90  Calothrix ...
WP_015201838       12 ALSDDTKQVVAAFEGLGTDEKLALLYFIYKEMGKSITQAAPAATDPQLAPKLLGDYLQLSN-EQQLAIMREIVNREHTEY 90  Crinalium ...
ASGPB:GKIL_4427   100 VRSEGLQQVRDQFDALDVDAKLAVLYYVYVEMGKSVTPAAPAAADRLRVQDFFNGFDALGQgEAQLEAMRALVRGDDTAL 179 Gloeobacte...
Q7NNZ8             63 ARSVGVRNAVEQFNALEVDDKLAVLYYLYEAMGESVTPAAPGAADIELTTAFFGEFNALTDgDTQLEAMRALVRCEDNTL 142 Gloeobacte...
5HGR_B             95 CRTYATWSPNIKLGFWNQLGEWMEQgAVAPIPAGYQLSANANAVLETLKSLDQGQQITVLRSSVVDMGFD 164 Nostoc sp. PCC 7120 ...
jgi:Cyan7822_0704  90 SRYYGGLSPNNQLFVWYAWAEAMGD-TVVDIPGNYKATEAVNNALSKIEGLDFEAQISILREIASNMGYS 158 Gloeothece verrucosa...
jgi:Osc7112_1512   90 SHAYGALTANNQLLVWYAWAIGMGE-RIVDIPEGYEATEAVNGLLDKIEGLDFEQQISVLRDVANNMGYT 158 Oscillatoria nigro-v...
WP_015150138       90 SHAYGALSANNQLVVWYAWAVGMGD-RIVDMPSDYQSTPETDRILSEIEQAEFEEQISILREIAGGMGYT 158 Oscillatoria acuminata
jgi:Cylst_3414     91 SRAYGALKENNQLYIWYVWAEEMED-TVVGMPDNYQSTKAINDLLSRLEELDFEEQISILRTISGQMGHT 159 Cylindrospermum stag...
jgi:Anacy_2740     92 SRAYGALKENNQLFVWYVWAEAMGD-TVVGMPDNYESDETIHDLLAQIEEIEFEAQISVLRTIAGQMGYS 160 Anabaena cylindrica ...
jgi:Cal7507_2842   91 SRAYGALKENNQLLVWYAWAVEMGD-TVVDIPDDYDETDTINDVLSQIEELDFDGQISVLRTIAGQMGHS 159 Calothrix sp. PCC 7507
WP_015201838       91 SHAYGVLKENNQLMVWFAWAQAMGH-TVVDMPSGYENSAPSNDVLNRIKALDFEGQISLLRTIASNMGYT 159 Crinalium epipsammum
ASGPB:GKIL_4427   180 GQTYGNFTENDKLFTWFLLAERMGK-DVIDVPADYKLSEDGNRALEAIKQLDFEQQITLLRDIAYAMGRT 248 Gloeobacter kilaueen...
Q7NNZ8            143 GREYGKLSENNKLVIWYLLAERMGD-DVIGMPDDYQLGDLGQQNLVHVKELDFEQQITFLRDVVNPMGHD 211 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap