1PGY


Conserved Protein Domain Family
Ubiq-assoc

?
pfam09145: Ubiq-assoc 
Click on image for an interactive view with Cn3D
Ubiquitin-associated
Ubiquitin associated domains contain approximately 40 residues and bind ubiquitin non-covalently. They adopt a secondary structure consisting of three alpha-helices, and have been identified in various modular proteins involved in protein trafficking, clathrin assembly/disassembly, DNA repair, proteasomal degradation, and cell cycle regulation.
Statistics
?
PSSM-Id: 401184
View PSSM: pfam09145
Aligned: 10 rows
Threshold Bit Score: 65.4561
Threshold Setting Gi: 47168543
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PGY_A         2 LVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKS 43  baker's yeast
CCH62483     216 VVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQA 257 Tetrapisispora blattae CBS 6284
CCF57178     124 VVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLER 165 Kazachstania africana CBS 2517
CAR27944     116 LVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKK 157 Zygosaccharomyces rouxii
Q74Z54       119 IADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAE 160 Eremothecium gossypii
Q6FRN9       130 VIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVLRKRKQ 171 [Candida] glabrata
XP_002556501  99 VVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKR 140 Lachancea thermotolerans CBS 6340
Q6CVQ6       133 LVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIESQKK 174 Kluyveromyces lactis
CCC70771     125 VVDEVKDMEVARLMSLGLSIDEANDHYDKGILYENLLAKMKQ 166 Naumovozyma castellii CBS 4309
XP_003669335 144 IVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQRE 185 Naumovozyma dairenensis CBS 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap