
Conserved Protein Domain Family

pfam09144: YpM 
Click on image for an interactive view with Cn3D
Yersinia pseudo-tuberculosis mitogen
Members of this family of Yersinia pseudo-tuberculosis mitogens adopt a sandwich structure consisting of nine strands in two beta sheets, in a jelly-roll topology. As with other super-antigens, they are able to excessively activate T cells by binding to the T cell receptor.
PSSM-Id: 72561
Aligned: 3 rows
Threshold Bit Score: 224.588
Created: 23-Mar-2022
Updated: 13-Oct-2022
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q93C63       115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151 Yersinia pseudotuberculosis
WP_012105075 115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151 Yersinia pseudotuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap