1PM4


Conserved Protein Domain Family
YpM

?
pfam09144: YpM 
Click on image for an interactive view with Cn3D
Yersinia pseudo-tuberculosis mitogen
Members of this family of Yersinia pseudo-tuberculosis mitogens adopt a sandwich structure consisting of nine strands in two beta sheets, in a jelly-roll topology. As with other super-antigens, they are able to excessively activate T cells by binding to the T cell receptor.
Statistics
?
PSSM-Id: 72561
View PSSM: pfam09144
Aligned: 3 rows
Threshold Bit Score: 224.588
Threshold Setting Gi: 42543297
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PM4_A         3 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 82 
Q93C63        35 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLYSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 114 Yersinia pseudo...
WP_012105075  35 IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGL 114 Yersinia pseudo...
1PM4_A        83 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 119
Q93C63       115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151 Yersinia pseudotuberculosis
WP_012105075 115 SWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV 151 Yersinia pseudotuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap