1S21


Conserved Protein Domain Family
AvrPphF-ORF-2

?
pfam09143: AvrPphF-ORF-2 
Click on image for an interactive view with Cn3D
AvrPphF-ORF-2
Members of this family of plant pathogenic proteins adopt an elongated structure somewhat reminiscent of a mushroom that can be divided into 'stalk' and 'head' subdomains. The stalk subdomain is composed of the N-terminal helix (alpha1) and beta strands beta3-beta4. An antiparallel beta sheet (beta5, beta7-beta8) forms the base of the head subdomain that interacts with the stalk. A pair of twisted antiparallel beta sheets (beta1 and beta6; beta2 and beta9/9') supported by alpha2 form the dome of the head. The head subdomain possesses weak structural similarity with the catalytic portion of a number of ADP-ribosyltransferase toxins.
Statistics
?
PSSM-Id: 401183
View PSSM: pfam09143
Aligned: 4 rows
Threshold Bit Score: 252.489
Threshold Setting Gi: 123721450
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S21_A  32 SRFVGQYTLTSIHQLSSEERENFLDAHDPMRVYDLNSETSVYRTTQREYV----RNGYATGNPNSGAIIALHEELQESP- 106 Pseudomonas savastano...
Q83YN7  30 SHRIGGETLTSIHQLSASQREQFLNTHDPMRKLRINNDTPLYRTTEKRFI----QEGKLAGNPKSIARVNLHEELQLNP- 104 Pseudomonas syringae ...
Q8XRK9 155 PPYI------PVDALPPPLSKAFLEAFDPIRSLGLTDQSVFYRALASRYLladgHQMKLAGNPRSGAYVRHHHRLLPSSg 228 Ralstonia solanacearum
Q88A90  29 STHVGGDTLTSIHQLSHSQREQFLNMHDPMRVMGLDHDTELFRTTDSRYI----KNDKLAGNPQSMASILMHEELRPNR- 103 Pseudomonas syringae ...
1S21_A 107 YAQH--IGARPDQAD---------AYRPRTAHVSSLNTPSLNVMAGQGALSALRGYAG--SDHVTTEMRLGDFLDQGGKV 173 Pseudomonas savastano...
Q83YN7 105 LASI--LGNLPHEAS---------AYFPKSARAADLKDPSLNVMTGSRAKNAIRGYAH--DDHVAVKMRLGDFLEKGGKV 171 Pseudomonas syringae ...
Q8XRK9 229 LASRetFESLPATARermlndpmqQYEWVRMRARDLPEPSLNVMFGVHAEAGARSYAKt-SDHVVVSMTFGDLRKAGGQV 307 Ralstonia solanacearum
Q88A90 104 FASH--TGAQPHEAR---------AYVPKRIKATDLGVPSLNVMTGSLARDGIRAYDHmsDNQVSVKMRLGDFLERGGKV 172 Pseudomonas syringae ...
1S21_A 174 YSDTSAMSAGGDSVEALIVTLPKGRKVPVNIL 205 Pseudomonas savastanoi pv. phaseolicola
Q83YN7 172 YADTSSVIDGGDEASALIVTLPKGQKVPVEII 203 Pseudomonas syringae pv. delphinii
Q8XRK9 308 FLDTRA-SAGSDHTKALIVTLPKGRTVPVKII 338 Ralstonia solanacearum
Q88A90 173 YADASSVADDGETSQALIVTLPKGQKVPVERV 204 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap