1IYJ


Conserved Protein Domain Family
Tower

?
pfam09121: Tower 
Tower
Members of this family adopt a secondary structure consisting of a pair of long, antiparallel alpha-helices (the stem) that support a three-helix bundle (3HB) at their end. The 3HB contains a helix-turn-helix motif and is similar to the DNA binding domains of the bacterial site-specific recombinases, and of eukaryotic Myb and homeodomain transcription factors. The Tower domain has an important role in the tumor suppressor function of BRCA2, and is essential for appropriate binding of BRCA2 to DNA.
Statistics
?
PSSM-Id: 401166
View PSSM: pfam09121
Aligned: 19 rows
Threshold Bit Score: 48.4983
Threshold Setting Gi: 296203683
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IYJ_B        427 VEKTVSGSYIFRNEREEEKEALRFAEAQQKKLEALFTKVHTE 468 
XP_002749005 2823 MEKTSSGLYIFRNEREEEKEAAKHAEAQQKRLEALFTKIQEE 2864 white-tufted-ear marmoset
Q66MH4       2761 VEKTVSGSYIFRNEREEEKEALRFAEAQQKKLEALFTKVHTE 2802 Norway rat
XP_016277359 2817 MEKTLSGSYIFRNERAEEKEALKYAECQQKKLEALLTKIQAE 2858 gray short-tailed opossum
Q864S8       2775 MEKTPSGLCIFRNEREEEREATKYAEAQQKKLEVLFNKIQAE 2816 domestic cat
XP_015197522 2563 MEKKADGVFVFRGDRAEEREARRHNENKQKTMEALFAKIQSE 2604 spotted gar
XP_008186509 1050 LEKKTNSKSIFRNEKMETIEAEKYKAYQQKSLEIISNKIKTE 1091 pea aphid
XP_005157420 2376 MEKKPNSVFIFRNDRAEDREARKHSNSKHKSLDLLISKIQTQ 2417 zebrafish
XP_014349572 2904 MEKKSDGIFVFRNDRAEEREAQRQVENQQRKMESLFAKIQTE 2945 coelacanth
ABP48763     2641 MEKMANGLYVFRNDRAEEREAEKHSANQQKKLEMLFSKIQAE 2682 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap