1JYO


Conserved Protein Domain Family
SicP-binding

?
pfam09119: SicP-binding 
Click on image for an interactive view with Cn3D
SicP binding
Members of this family bind the chaperone SicP, which is required both to maintain the stability of SptP, as well as to ensure the eventual secretion of the protein. The domain is found in the Salmonella effector protein SptP, which interacts with SicP chaperone dimers mainly through four regions of its chaperone-binding domain. The structure of the SptP-SicP complex contains four molecules of SicP, aligned in a linear fashion and arranged in two sets of tightly bound homodimers that bind two SptP molecules. The SicP homodimers do not interact with each other, but are held together by a molecular interface formed between two SptP molecules. Each SptP molecule is wrapped around by three SicP chaperones (two chaperones from one homodimer and a third one from the opposite homodimer pair).
Statistics
?
PSSM-Id: 401165
View PSSM: pfam09119
Aligned: 2 rows
Threshold Bit Score: 139.011
Threshold Setting Gi: 16974850
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JYO_F   7 APEKFSSKVLTWLGKMPLFKNTEVVQKHTENIRVQDQKILQTFLHALTEKYGETAVNDALLMSRINMNKPLTQRLA---V 83  Salmonella enterica s...
Q63K42  31 ARLGMKERLFAFLAHVPLLKHCDAVRRYAEQVRMENRRSLEVFVLALSKRYGPEGAKAAFDYGARRDGAPLDQRRVrnmV 110 Burkholderia pseudoma...
1JYO_F  84 QITE 87  Salmonella enterica subsp. enterica serovar Typhimurium
Q63K42 111 SIAE 114 Burkholderia pseudomallei K96243
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap