2UWM


Conserved Protein Domain Family
SelB-wing_1

?
pfam09105: SelB-wing_1 
Click on image for an interactive view with Cn3D
Elongation factor SelB, winged helix
Members of this family adopt a winged-helix fold, with an alpha/beta structure consisting of three alpha-helices and a twisted three-stranded antiparallel beta-sheet, with an alpha-beta-alpha-alpha-beta-beta connectivity. They are involved in both DNA and RNA binding.
Statistics
?
PSSM-Id: 370297
View PSSM: pfam09105
Aligned: 3 rows
Threshold Bit Score: 90.6672
Threshold Setting Gi: 149243816
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UWM_A         1 GSPEKILAQIIQEHREGLDWQEAATRASLSLEETRKLLQSMAAAGQVTLLRVENDLYAIST 61 
Q2RFK4       377 GSPEKILAQIIQEHREGLDWQEAATRASLSLEETRKLLQSMAAAGQVTLLRVENDLYAIST 437 Moorella thermoacetica ATCC 39073
WP_054936960 377 GSPQEILAQVVREHRDGLDWQEAAARAALTPQETRKLLQDMAAAGQLTLLAADNDLYAVSN 437 Moorella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap