Conserved Protein Domain Family
MIF4G_like

?
pfam09088: MIF4G_like 
MIF4G like
Members of this family are involved in mediating U snRNA export from the nucleus. They adopt a highly helical structure, wherein the polypeptide chain forms a right-handed solenoid. At the tertiary level, the domain is composed of a superhelical arrangement of successive antiparallel pairs of helices.
Statistics
?
PSSM-Id: 370287
View PSSM: pfam09088
Aligned: 6 rows
Threshold Bit Score: 320.551
Threshold Setting Gi: 758987643
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CH33        324 PDPKSYDAVLWRDMLSDTIQNLDFNRKECAKQLFTLDLFLNKGTFTGPGISVDKLsgkfldaKADDRPISTLKVEDVASE 403  Yarrowia lipo...
Q4WDL2        127 PPTSDIASSLLREALVDTINILDFNRIATAKFLIDVDCYFTPYTFVKRATPFDRL-------RDLPGDRPTWKPEDVAVD 199  Aspergillus f...
Q2GXY9        312 PPLTHIAASVIRDALLDTINVLHINRNVTARHLIDLDCYFSPRTFAARATPFDKL-------RDIEPPKSTWKPEDVAVD 384  Chaetomium gl...
O14253        309 PDASDVAASIFRDISVDVINHLEFNRVEAAQVLTDLDVYFTYKTFALRGTPVNEL-------PNLDPSESRWKAEDIIVE 381  Schizosacchar...
XP_011392571  439 PAVASPASVVLRAILADMIDLYEVNRKEAAKLILDLPNWLRRATFNLKVSSDAGLfge---mgdVNPGESNWSLDDLLVE 515  Ustilago mayd...
Q5KMU1        379 PSPSTLDGWYLRSLVLDIINLYEVNRKECSRLLLELRKFLPRDTFKPIVPLPED----------ASPPPSTWSLESLVVS 448  Cryptococcus ...
Q6CH33        404 AILAELFRLATPPLQPAYFHSLFIEACIMAPQAIAPVFGRAVRFLFANLRS--FDTELIHRFLDWFSHHLSNFGFTWKWQ 481  Yarrowia lipo...
Q4WDL2        200 AVFSQLFQLPSPEHKLVYYHSVLTECCKIAPAAIAPSLGRAIRFLYRSLDT--IDLELMHRFLDWFAHHLSNFGFTWKWS 277  Aspergillus f...
Q2GXY9        385 AVFSQLFQLPTPEQKLVYYHSVLTEACKLAPAAIAPSLGRAIRHLYRNTPR--LDLELSSRFVDWFAHHLSNFGFTWKWT 462  Chaetomium gl...
O14253        382 AVLGELLGSQNTTYKPVYYHSLLIECCRIAPKILAPTFGRVIRLMYTMSSD--LPLQTLDRFIDWFSHHLSNFNFHWKWN 459  Schizosacchar...
XP_011392571  516 TILSTAFVLPTPPRNPLYYTSLLREIVTLTPGTVAPSLGKTIRTFYDALSSrnMDVETIHRFADWFAIHLSNFNFGWAWK 595  Ustilago mayd...
Q5KMU1        449 TLLGAMLTLPKSHHKLIYYGSVITELCKASPNTVAPPVGRSMRKIFSLLGTegLDVEIVRRVAEWFSVHLSNFGFQWMWK 528  Cryptococcus ...
Q6CH33        482 EWVEYVDLEPLDPRLVFIKQLIKKELRLSFESRIKETLPD 521  Yarrowia lipolytica
Q4WDL2        278 EWIEDLELPLVHPRMAFITGAIDKEIRLSFAQRIRGTLPD 317  Aspergillus fumigatus
Q2GXY9        463 EWVDDVSLPDAHPRKAFIAGALDKEIRLSFAQRIKNTLPD 502  Chaetomium globosum CBS 148.51
O14253        460 EWIPDVELDDLHPKKVFMRETITRELILSYYTRISDSLPE 499  Schizosaccharomyces pombe 972h-
XP_011392571  596 EWIPDTTLPAAHPKIVFMKRVVELEIRLAYFDRVKQTLPD 635  Ustilago maydis 521
Q5KMU1        529 EWVPDLELPSSHPRRAFMRRVIELEVRLSYYDRILETLPE 568  Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap