1F6V


Conserved Protein Domain Family
Phage-MuB_C

?
pfam09077: Phage-MuB_C 
Click on image for an interactive view with Cn3D
Mu B transposition protein, C terminal
The C terminal domain of the B transposition protein from Bacteriophage Mu comprises four alpha-helices arranged in a loosely packed bundle, where helix alpha1 runs parallel to alpha3, and anti-parallel to helices alpha2 and alpha4. The domain allows for non-specific binding of Mu to double-stranded DNA, allowing for integration into the bacterial genome, and mediates dimerization of the protein.
Statistics
?
PSSM-Id: 401135
View PSSM: pfam09077
Aligned: 12 rows
Threshold Bit Score: 86.9946
Threshold Setting Gi: 157910415
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1F6V_A             2 SRIAKRTAINKTKKADVKAIADAWQI--NGEKELELLQQIAQKPGALRILNHSLRLAAMTAHGKGERV-NEDYLRQAFRE 78  Escherichia...
USMARC:WQG_17120 222 SRISKHVSIQKCKKNDVVAIANAWGLdtNDQEMMSLLSEIGAGGGGLRSLTQTLRLAGIHAKGQDSVI-TRDLVLAAQAE 300 Bibersteini...
Q8EDT8           239 SRIAKKLSINKTKQADVRAIAKAWNL--QHDAEISLMIQISEKPGGLRLLSKTLKLAAMFAKGAA--I-TEALLRTAFNE 313 Shewanella ...
CBJ91406         236 SRIAKKVAILKTKKDDVQAISAAWGL---GQQERALVHQLAERPGALRTVSHTLRLAAMFARGANETL-SETHIRAAVKD 311 Xenorhabdus...
WP_002442885     226 SRIAKRVAINKTKKADVTAIADAWHI--TGEKERDLLQQIAQKPGALRILSHSLRLAAMTAHGAGHEV-SEGYIRKALRD 302 Enterobacte...
Q7VPI3           222 NRIGKKCQIKASKKGDIKAVAQAWGLdvQDKDLMTVLYDIGGKAGGLRALTQYLRLAGMTAKGQGTGI-TLDLILTAQAE 300 [Haemophilu...
jgi:Tgr7_1664    242 SRQGKWVGIQKTTAKDIAALVAAWHI--DDSRVMDAAQEIGSRPGGLRGLTKALRLASMFAAGEGGAM-QREHLVQAWRD 318 Thioalkaliv...
WP_012251219     240 SRVAKRVRLSRAKDADVLTLLDAWRI--EDAEARQLCLGIGRRPGALRGLSQTLRLASMFAATSGAARpTAEHVRDAWQD 317 Bordetella ...
jgi:Dshi_0099    173 rRMVRPVVIRSVPKPDVLAVVRSRGI--TDPAICDALSVMARRYGGLADVQRTLAQAAKHASSDKI---AASDVKAA--- 244 Dinoroseoba...
jgi:Xaut_4524    232 SRVGARFVGASAKARDIEMLIAAWGV--TDEGVTKVLRAIARKPGALRLVGKTIRAASMYAEAEEIGQiSATHIRQAWSQ 309 Xanthobacte...
WP_015948322     239 SRIGRKLRLKKPSENDIKAICQAMGV--TEPMAQKYCVEIAHKPEAMRGMIETIQVAALFANGAGQEL-GLKHIKAAWKD 315 Desulfatiba...
vbi:Avi_3067     264 SRIGKRLQRVQPYPEDLQTYIAAWSV--TDPACIKFLMGIGMKGGAFRQIEKTMRMARMVATGEGTEV-SLKFIQAAWKn 340 Agrobacteri...
1F6V_A            79 L 79  Escherichia virus Mu
USMARC:WQG_17120 301 L 301 Bibersteinia trehalosi USDA-ARS-USMARC-192
Q8EDT8           314 L 314 Shewanella oneidensis
CBJ91406         312 L 312 Xenorhabdus nematophila ATCC 19061
WP_002442885     303 L 303 Enterobacteriaceae
Q7VPI3           301 M 301 [Haemophilus] ducreyi
jgi:Tgr7_1664    319 L 319 Thioalkalivibrio sulfidiphilus HL-EbGr7
WP_012251219     318 L 318 Bordetella petrii
jgi:Dshi_0099    245 M 245 Dinoroseobacter shibae DFL 12 = DSM 16493
jgi:Xaut_4524    310 L 310 Xanthobacter autotrophicus Py2
WP_015948322     316 r 316 Desulfatibacillum aliphaticivorans
vbi:Avi_3067     341 r 341 Agrobacterium vitis S4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap