1EHS


Conserved Protein Domain Family
STb_secrete

?
pfam09075: STb_secrete 
Heat-stable enterotoxin B, secretory
Members of this family assume a helical secondary structure, with two alpha helices forming a disulphide crosslinked alpha-helical hairpin. The disulphide bonds are crucial for the toxic activity of the protein, and are required for maintenance of the tertiary structure, and subsequent interaction with the particulate form of guanylate cyclase, increasing cyclic GMP levels within the host intestinal epithelial cells.
Statistics
?
PSSM-Id: 401134
View PSSM: pfam09075
Aligned: 3 rows
Threshold Bit Score: 74.3612
Threshold Setting Gi: 157830950
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EHS_A        1 STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC 48 
Q70Q73       24 STQSNKKDLCENYRQIAKESCKIGFLGVRDGTAGACFGAQIMVAAKGC 71  Escherichia coli
WP_000739296 24 STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC 71  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap