1DQ3


Conserved Protein Domain Family
Endonuc_subdom

?
pfam09062: Endonuc_subdom 
Click on image for an interactive view with Cn3D
PI-PfuI Endonuclease subdomain
The endonuclease subdomain, found in the prokaryotic protein ribonucleotide reductase, assumes an alpha-beta-beta-alpha-beta-beta-alpha-alpha topology. The four stranded beta-sheet forms a saddle-shaped surface and assembles together through an interface made of alpha-helices. The presence of 14 basic residues on the surface of the beta-sheets suggests that this large groove may be involved in DNA binding.
Statistics
?
PSSM-Id: 401124
View PSSM: pfam09062
Aligned: 2 rows
Threshold Bit Score: 204.776
Threshold Setting Gi: 9256860
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DQ3_A  129 PDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETFEIINDYLEKTFGRKYSIQKDRNIYYIDIK 208  Pyrococcus furiosus
Q5JJ43  430 PSDDDYEFLLDYWLAGFIAGDGSIDKYRSHVKGHEYVYDRLRIYDYTTETLGIINDHLEKTFGKRYSLQRDRNIHYIDIK 509  Thermococcus kodaka...
1DQ3_A  209 ARNITSHYLKLLEGIDNG 226  Pyrococcus furiosus
Q5JJ43  510 AKGITSHYIELLRGITNG 527  Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap