1DQ3


Conserved Protein Domain Family
Stirrup

?
pfam09061: Stirrup 
Click on image for an interactive view with Cn3D
Stirrup
The Stirrup domain, found in the prokaryotic protein ribonucleotide reductase, has a molecular mass of 9 kDa and is folded into an alpha/beta structure. It allows for binding of the reductase to DNA via electrostatic interactions, since it has a predominance of positive charges distributed on its surface.
Statistics
?
PSSM-Id: 401123
View PSSM: pfam09061
Aligned: 2 rows
Threshold Bit Score: 168.315
Threshold Setting Gi: 9256860
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DQ3_A  336 GNFGLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIE 414  Pyrococcus furiosus
Q5JJ43  637 GSFGLTLSFEDFKAWSSKYGVEFKTNGSQTLAIIKNEKVSLGQWHRRGRVSKAVLVKMLRKLYDTTKSEDVKRMLHLIE 715  Thermococcus kodakar...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap