1VF6


Conserved Protein Domain Family
L27_N

?
pfam09060: L27_N 
L27_N
The L27_N domain plays a role in the biogenesis of tight junctions and in the establishment of cell polarity in epithelial cells. Each L27_N domain consists of three alpha-helices, the first two of which form an antiparallel coiled-coil. Two L27 domains come together to form a four-helical bundle with the antiparallel coiled-coils formed by the first two helices. The third helix of each domain forms another coiled-coil packing at one end of the four-helix bundle, creating a large hydrophobic interface: the hydrophobic interactions are the major force that drives heterodimer formation.
Statistics
?
PSSM-Id: 401122
View PSSM: pfam09060
Aligned: 15 rows
Threshold Bit Score: 61.955
Threshold Setting Gi: 1465395681
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VF6_C        15 DVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT 62 
XP_015206665 122 DLEDLLASLKHIQYSLSDSQSQEDISVVLQLIQKTDFQNAFQIHNAVA 169 spotted gar
XP_005991525 125 DVDELLSSLKQVQHGLVDSQSQEDMSVILQLVQNSEFQNAFKIYNAVA 172 coelacanth
XP_015142825 123 EVEELLTSLKHIQHVLVDPQSQEDLALILQLVQNTDFQNAFKIHNAVT 170 chicken
PNI83881      89 EIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAIT 136 chimpanzee
EEN66266      81 ELDELFSSLGHIQGKLNSREA-DDVAFLKNLFHDSDFQTAVRIHNLVS 127 Florida lancelet
XP_003446337 110 ELEELLQTLKWVQHCLTDAQSQQDVELITQLLTKEDFRTAYSIYSAVS 157 Nile tilapia
XP_022540120 115 ELNDLLQSLQRVRYSLGDAESQADVQVVMELLQQREFQQAFSMHSTVA 162 Mexican tetra
NP_001171218  86 DLDSVLQCLHHLHQCVLDEESQQDVELLLDLLLQTNFQQAFIMQRSVA 133 zebrafish
Q1LVF4       150 ELEDLLMSLKQVQHNLNDSQSQEDVELVLQLVQKPDFQKAFSIHNSVA 197 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap