4RP3


Conserved Protein Domain Family
L27_1

?
pfam09058: L27_1 
L27_1
The L27 domain is a protein interaction module that exists in a large family of scaffold proteins, functioning as an organisation centre of large protein assemblies required for the establishment and maintenance of cell polarity. L27 domains form specific heterotetrameric complexes, in which each domain contains three alpha-helices.
Statistics
?
PSSM-Id: 401120
View PSSM: pfam09058
Aligned: 23 rows
Threshold Bit Score: 78.4326
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RP3_A          3 PVKKQEAH-RALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTLLD 63  
XP_001638121    1 -IYKLDAD-RALQLLESYHEKLNKPQDKALRSAIERVIRIFQSRLFLALLDIQEFYEATLLD 60   starlet sea anemone
ESN99685        1 ----QDAH-RALELLEAYHDKLTDHQDLPLKNAIENVIRIFKSCLFQALLDIQEFYEVTLMN 57   Helobdella robusta
PDM83729       83 HRKIEDAH-RALEQIEDFCNQLSDPRDDEFRRHIQALIDCFKENLFSALLELQDLFDYTLLN 143  Pristionchus pacificus
CAP33141       17 RRKCSEGAhQSIELLEEYHLALSRHTDEELRTTIETLITRFKSNLMNTLLDIHDLYEQTLLN 78   Caenorhabditis briggsae
XP_003118044   23 SVESSERAhQAIERLEEYFLTLSRHTDEELRSSVERLINTFKSQLMHTLIDIHDLYEGTLLS 84   Caenorhabditis remanei
G5ECY0          2 SHESSEKAhKAIENVEDYCQTLTRHGNEELRTNLERVITTFKSNLMHSLLDIHDLYEQTLLS 63   Caenorhabditis elegans
7_pfamImport    1 SIESSERAhQAIELIEDYHQTLNRHTDEELRTSLEKLISTFKAHLVHTLLEIHDLYEQTLLS 62  
ESN96607       47 TMSRSDAH-RALELLEEYYGRLIRPQDQNLRLAIERVIRIFKSRLFQALLDIQEFYEVTLLD 107  Helobdella robusta
XP_001948578    2 PVCKQDETlRALALLEDYHAKLSTVPDNDLQVVMQLVIGVFKSRLFQALVDIQEFYELALQD 63   pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap