2FM8


Conserved Protein Domain Family
SipA

?
pfam09052: SipA 
Click on image for an interactive view with Cn3D
Salmonella invasion protein A
Salmonella invasion protein A is an actin-binding protein that contributes to host cytoskeletal rearrangements by stimulating actin polymerization and counteracting F-actin destabilizing proteins. Members of this family possess an all-helical fold consisting of eight alpha-helices arranged so that six long, amphipathic helices form a compact fold that surrounds a final, predominantly hydrophobic helix in the middle of the molecule.
Statistics
?
PSSM-Id: 401115
View PSSM: pfam09052
Aligned: 3 rows
Threshold Bit Score: 345.345
Threshold Setting Gi: 123560688
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FM8_C  28 QLEDFPALIKQASLDALFKCGKDAEALKEVFTNSNNVAGKKAIMEFAGLFRSALNATSDSPEAKTLLMKVGAEYTAQIIK 107 Salmonella enterica s...
Q7NUT1  50 DLASYQADYARRSVATLFAASPHADKLGELYQASPNRYAKLEIAEFAKVYSQLKRQPDLDPAAGKTLDDLAQQYAARILK 129 Chromobacterium viola...
Q326T2  49 EKESFATSFNQKCLDFLFSSSGKEDVLRSIYSNSMNAYAKSEIIEFSNVLYSLVHQNGLNFENEKGLQKIVAQYSELIIK 128 Shigella dysenteriae ...
2FM8_C 108 DGLKEKSAFGPWLPETKKAEAKLENLEKQLLDIIKNNTGGELSKLSTNLVMQEVMPYIASCIEHNFGCTLDPLTRSNLTH 187 Salmonella enterica s...
Q7NUT1 130 DGLGEKSAFGPWTQRTDKHYQLRSGLERKLAEIASRHCQGDAQKLGNDFMRAEVTTFILSCVETHLGRQLDEATSRQITG 209 Chromobacterium viola...
Q326T2 129 DKLSQDSAFGPWSAKNKKLHQLRQNIEHRLALLAQQHTSGEALSLGQKLLNTEVSSFIKNNILAELKLSNETVSSLKLDD 208 Shigella dysenteriae ...
2FM8_C 188 LVDKAAAKAVEALDMCHQKLTQEQGTSVGREARHLEMQTLIPLLLRNVFAQIP 240 Salmonella enterica subsp. enterica serovar Typh...
Q7NUT1 210 LVDSAAMQAFEDLRQRRGDLIEQRGFSVGTLARDLDTVAVLPQLLRSLLEALP 262 Chromobacterium violaceum
Q326T2 209 LVDAQAKLAFDSLRNQRKNTIDSNGFGIGKLSRDLNTVAVFPELLRKVLNNIL 261 Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap