5CRO


Conserved Protein Domain Family
Cro

?
pfam09048: Cro 
Click on image for an interactive view with Cn3D
Cro
Members of this family are involved in the repression of transcription by binding as a homodimer to palindromic DNA operator sites in phage lambda: they repress genes expressed in early phage development and are necessary for the late stage of lytic growth. These proteins have a secondary structure consisting of three alpha-helices and three beta-sheets, and dimerize through interactions between the two antiparallel beta-strands.
Statistics
?
PSSM-Id: 401112
View PSSM: pfam09048
Aligned: 5 rows
Threshold Bit Score: 102.973
Threshold Setting Gi: 502752256
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5CRO_A        1 MEqRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPS 60  Escherichia virus Lambda
WP_012987240  1 ME-KILLSEYVKKNGQVKAASLVGVHQTAISKALRAGRKIFLIRQEDGSYKAEECRPFPS 59  Xenorhabdus bovienii
CCH:MU9_2927  1 ME-RIPLTTFATEVGQHKTAEMLGVRQSAISKAILKKRNIYVIKKQDGTVEAEEVKTFPS 59  Morganella morganii subsp. morganii KT
Q87Y09        1 ME-RISLSDFVTKIGQARVARALGCKPASIAKALKARRNIEVSVDTDGSCIAQEVRPFPS 59  Pseudomonas syringae pv. tomato
Q32F75        3 MK-KETLADYVYRFGQKKAAKDFGVAQSAISKALLVGREIYVKTFDDGTVEAEEVRPFPA 61  Shigella dysenteriae Sd197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap