2FD4,2FD4


Conserved Protein Domain Family
AvrPtoB-E3_ubiq

?
pfam09046: AvrPtoB-E3_ubiq 
Click on image for an interactive view with Cn3D
AvrPtoB E3 ubiquitin ligase
The E3 ubiquitin ligase domain found in the bacterial protein AvrPtoB inhibits immunity-associated programmed cell death (PCD) when translocated into plant cells, probably by recruiting E2 enzymes and transferring ubiquitin molecules to cellular proteins involved in regulation of PCD and targeting them for degradation. The structure of this domain reveals a globular fold centred on a four-stranded beta-sheet that packs against two helices on one face and has three very extended loops connecting the elements of secondary structure, with remarkable homology to the RING-finger and U-box families of proteins involved in ubiquitin ligase complexes in eukaryotes.
Statistics
?
PSSM-Id: 401111
View PSSM: pfam09046
Aligned: 2 rows
Threshold Bit Score: 248.957
Threshold Setting Gi: 85544682
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FD4_A   5 AALDPIASQFSQLRTISKADAESEELGFKDAADHHTDDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLA 84  Pseudomonas syringae
2FD4_A   5 AALDPIASQFSQLRTISKADAESEELGFKDAADHHTDDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLA 84  Pseudomonas syringae
2FD4_A  85 FMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP 122 Pseudomonas syringae
2FD4_A  85 FMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP 122 Pseudomonas syringae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap