Conserved Protein Domain Family
Transglut_prok

?
pfam09017: Transglut_prok 
Microbial transglutaminase
Microbial transglutaminase (MTG) catalyzes an acyl transfer reaction by means of a Cys-Asp diad mechanism, in which the gamma-carboxyamide groups of peptide-bound glutamine residues act as the acyl donors. The MTG molecule forms a single, compact domain belonging to the alpha+beta folding class, containing 11 alpha-helices and 8 beta-strands. The alpha-helices and the beta-strands are concentrated mainly at the amino and carboxyl ends of the polypeptide, respectively. These secondary structures are arranged so that a beta-sheet is surrounded by alpha-helices, which are clustered into three regions.
Statistics
?
PSSM-Id: 117583
View PSSM: pfam09017
Aligned: 4 rows
Threshold Bit Score: 836.603
Threshold Setting Gi: 75391930
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6Q6T1   1 MYKRRSLLAFATVGALICTAGVMPSVSHA----ASGGDGEWEGSYAETHDLTAEDVKNINALNKRALTAGQPGNSPAELS 76  Streptomyces platensis
Q8GR90   1 MHKRRRLLAFATVGAVICTAGFTPSVSQA----ASSGDGEEKGSYAETHGLTADDVESINALNERALTLGQPGKPPKELP 76  Streptomyces cinnamoneus
Q6RET8   1 MRIRRRALVFATMSAVLCTAGFMPSAGEAa---ADNGAGEETKFYAETYRLTADDVANINALNESAPAASSAG------- 70  Streptomyces mobaraensis
Q84AM9   1 MSQRGRTLVFAALGAVMCTTALMPSAGAAtgsgSGSGTGEEKRSYAETHRLTADDVDDINALNESAPAASSAG------- 73  Streptomyces mobaraensis
Q6Q6T1  77 PSasalFRAPDAV--DDRVTPPAEPLNRMPDAYRAYGGRATTVVNNYIRKWQQVYSQRGGNPQQMTEEQREQLSYGCVGV 154 Streptomyces platensis
Q8GR90  77 PS----ASAPSRApsDDRETPPAEPLDRMPEAYRAYGGRATTVVNNYIRKWQQVYSHRDGKKQQMTEEQREKLSYGCVGV 152 Streptomyces cinnamoneus
Q6RET8  71 PS----FRAPDS---DDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGV 143 Streptomyces mobaraensis
Q84AM9  74 PS----FRAPDS---DERVTPPAEPLDRMPDPYRPSYGRAETIVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGV 146 Streptomyces mobaraensis
Q6Q6T1 155 TWVNTGPYPTNKLAFAFFDENKYKNDLENSRPRPNETQAEFEGRIAKDSFDEGKGFKRAREVASVMNKALDNAHDEETYI 234 Streptomyces platensis
Q8GR90 153 TWVNSGPYPTNRLAFASFDENKYKNDLKNTSPRPDETRAEFEGRIAKGSFDEGKGFKRARDVASVMNKALENAHDEGTYI 232 Streptomyces cinnamoneus
Q6RET8 144 TWVNSGQYPTNRLAFASFDEDRFKNELKNGRPRSGETRAEFEGRVAKESFDEEKGFQRAREVASFMNRALENAHAESAYL 223 Streptomyces mobaraensis
Q84AM9 147 TWVNSGQYPTNRLAFAFFDEDKYKNELKNGRPRSGETRAEFEGRVAKDSFDEAKGFQRARDVASVMNKALENAHDEGAYL 226 Streptomyces mobaraensis
Q6Q6T1 235 GHLKTELANKNDALLYEDSRSSFYSALRNTPSFKERDGGNYDPSKMKAVVYSKHFWSGQDQRGSSEKRKYGDPDAFRPGQ 314 Streptomyces platensis
Q8GR90 233 NNLKTELTNNNDALLREDSRSNFYSALRNTPSFKERDGGNYDPSKMKAVIYSKHFWSGQDQRGSSDKRKYGDPEAFRPDQ 312 Streptomyces cinnamoneus
Q6RET8 224 DNLKKELANGNDALRNEDARSPFYSALRNTPSFKERNGGNHDPSRMKAVIYSKHFWSGQDRSSSADKRKYGDPDAFRPAP 303 Streptomyces mobaraensis
Q84AM9 227 DNLKKELANGNDALRNEDARSPFYSALRNTPSFKDRNGGNHDPSKMKAVIYSKHFWSGQDRSGSSDKRKYGDPEAFRPDR 306 Streptomyces mobaraensis
Q6Q6T1 315 GTGLVDMSRDRNIPRSPAKPGESWVNFDYGWFGAQAEADADKTVWTHANHYHAPNGGMGPMNVYESKFRNWSAGYADFDR 394 Streptomyces platensis
Q8GR90 313 GTGLVDMSKDRSIPRSPAKPGEGWVNFDYGWFGAQTEADADKTTWTHGDHYHAPNSDLGPMHVHESKFRKWSAGYADFDR 392 Streptomyces cinnamoneus
Q6RET8 304 GTGLVDMSRDRNIPRSPTSPGEGFVNFGYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSEGYSDFDR 383 Streptomyces mobaraensis
Q84AM9 307 GTGLVDMSRDRNIPRSPTSPGESFVNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSDGYSDFDR 386 Streptomyces mobaraensis
Q6Q6T1 395 GAYVITFIPKSWNTAPAEVKQGWP 418 Streptomyces platensis
Q8GR90 393 GAYVITFIPKSWNTAPAKVEQGWP 416 Streptomyces cinnamoneus
Q6RET8 384 GAYVITFIPKSWNTAPDKVKQGWP 407 Streptomyces mobaraensis
Q84AM9 387 GAYVVTFVPKSWNTAPDKVTQGWP 410 Streptomyces mobaraensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap