1LKT


Conserved Protein Domain Family
Head_binding

?
pfam09008: Head_binding 
Click on image for an interactive view with Cn3D
Head binding
The head binding domain found in the Phage P22 tailspike protein contains two regular beta-sheets, A and B, oriented nearly perpendicular to each other and composed of five and three strands respectively. The topology of the strands is exclusively antiparallel. The tailspike protein trimerizes through this domain, and the direction of the strands with respect to the molecular triad is almost parallel for beta-sheet A, whereas beta-sheet B is perpendicular to the triad, forming a dome-like structure. This domain is dispensable for thermostability and SDS resistance of the intact protein, and its deletion has only minor effects on tailspike folding kinetics.
Statistics
?
PSSM-Id: 401088
View PSSM: pfam09008
Aligned: 4 rows
Threshold Bit Score: 174.701
Threshold Setting Gi: 2914349
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LKT_D                2 NVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPANQIPVYIENEDGSHVQITQPLIINAAGKIVYNGQLVKIVTVQ 81  Salmonel...
CCH:MU9_2889          7 NVVVSMPSQLFTLARKFQAASNGKIFIGKIDTDPTIQENQIQVYLENEDGTTVPVSQPLIINQAGYPVYNGQIAKFITVQ 86  Morganel...
goetting:EBL_c21660   7 NVVVSMPSQLFTLARQFKANANGKIYIGQIDTDPVNPDNQIQVYIENEDGSLVPVPQPIIINAGGYPVYNGQVSKFVTVK 86  Shimwell...
ACQ68299              7 NIVVSMPTQLFTLRRKFQACSNGKIYIGKSNTDPTIPTNQIQVYIENEDGSTVPVAQPIMINHAGFPVYNGQIAKFVTVE 86  Candidat...
1LKT_D               82 GHSMAIYDANGSQVDYIANVLKY 104 Salmonella virus P22
CCH:MU9_2889         87 GHSMAVYDSYGAQQFYYPNVLKY 109 Morganella morganii subsp. morganii KT
goetting:EBL_c21660  87 GHSMAVYDAYGTQQFYYPNIIKY 109 Shimwellia blattae DSM 4481 = NBRC 105725
ACQ68299             87 SHSMAVYDSDGAQQFYFADILKY 109 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap