Conserved Protein Domain Family
DUF1897

?
pfam09005: DUF1897 
Domain of unknown function (DUF1897)
This domain is found in Psi proteins produced by Drosophila, and in various eukaryotic hypothetical proteins. It has no known function.
Statistics
?
PSSM-Id: 401086
View PSSM: pfam09005
Aligned: 20 rows
Threshold Bit Score: 49.7281
Threshold Setting Gi: 122117678
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q173N9       501 QQAGGGQADYSQQWIEYYRQMGMHREAEMIEQQVK 535 yellow fever mosquito
EGT52301     481 VNPTTGAPDYSAQWAAYYRSIGLNEQAAMVETQMR 515 Caenorhabditis brenneri
EFX88735     571 VNPQTGQPDYTAQWIQYYRSIGAMKDAEALEQQLK 605 common water flea
Q2XMZ9       454 VDPVTGEQDYSAQWMEYYKSIGAHDKAEAVEAQMK 488 Caenorhabditis elegans
2_pfamImport   1 -NPKDGEQDFSAQWLEYYISIGDTEGANGVRARIA 34 
Q9BLA0       586 GSAKDGDADYSAQWLEYYIHIGDQASADAVRERIA 620 Caenorhabditis elegans
BAH72180      50 GTVGAGTPDYSAQWIEYYRSIGKNKEADMVEQQVK 84  pea aphid
ETN66059     593 QQQVGGQADYSAEWAEYYRRVGKIEEAEAIEKQIA 627 Anopheles darlingi
XP_002034191 649 GGAGAGGADYSAQWAEYYRSVGKIEEAEAIEKTLK 683 Drosophila sechellia
XP_023247829 401 tQQNGSQADYSAQWAEYYRSIGKIKEAEAIEAQMK 435 Copidosoma floridanum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap