5XTE


Conserved Protein Domain Family
UCR_6-4kD

?
pfam08997: UCR_6-4kD 
Click on image for an interactive view with Cn3D
Ubiquinol-cytochrome C reductase complex, 6.4kD protein
The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is an essential component of the mitochondrial cellular respiratory chain. This family represents the 6.4kD protein, which may be closely linked to the iron-sulphur protein in the complex and function as an iron-sulphur protein binding factor.
Statistics
?
PSSM-Id: 401083
View PSSM: pfam08997
Aligned: 14 rows
Threshold Bit Score: 53.8541
Threshold Setting Gi: 190621498
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XTE_T         1 VTRF-LGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKF 51  human
EEZ99280      33 flRM-IGPKHIRVLMAFVPSAICYTFTSLILVTYMSEWKTVLQYFPYYNGKY 83  red flour beetle
EFA11572      10 plRL-IGKKHIEIASQWIGSAVAFGATAGVGITYATDWKLILQYMPYYNGKF 60  red flour beetle
ETN66106       1 -mRIpLGRKQAEQAAQWATSAGAYGAAAALIGCYLTDWKVIVTYIPFYGGKF 51  Anopheles darlingi
XP_001847960  81 kmRIpIGPKQAEQATKWISSAVGFGAAGSLIGLYLTDWRCIVTYIPFYGGKF 132 southern house mosquito
NP_001177731   2 LSKL-VGPRYVQLLQNWTPTLVTWGAVGGTGLVWITDWKLVLQYVPYIGGKY 52  chicken
Q4SDD2         6 LNKV-VGTKYVAVVRAWVPNMVAWGTVGGVALVHFTDWRLFLDYVPYVKGKF 56  spotted green pufferfish
Q4RV41         2 ITKL-IGQKYTSIAKSWIPTLAVWGAAGGVALVHFTDWRLFLDYVPYVNNKF 52  spotted green pufferfish
XP_005992007   2 LGKV-LGPRYYQLLKNWVPTLATWGTVGGVTLVYSTDWRVVLDYVPYINGKF 52  coelacanth
NP_001119569   2 LSRF-LGPRYRELAKNWIPTAGMWGTVGAVGLVWVTDWRLILDWVPYINGKF 52  Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap