Conserved Protein Domain Family
NIP_1

?
pfam08995: NIP_1 
Necrosis inducing protein-1
Necrosis inducing protein-1, a fungal avirulence protein produced by plants, consists of two parts containing beta-sheets of two and three anti-parallel strands, respectively. Five intramolecular disulfide bonds, stabilize these parts and their position with respect to each other, providing a high level of stability.
Statistics
?
PSSM-Id: 117561
View PSSM: pfam08995
Aligned: 3 rows
Threshold Bit Score: 134.743
Threshold Setting Gi: 74627600
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5DS10  1 MKFLVLPLSLAFLQIGLVFSTPDRCRYTLCCEGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYR 80  leaf blotch of barley
Q5DRZ7  1 MKFLVLPLSLAFLQIGLVFSTPDRCRYTLCCDGALKAVSECLVESESCLIPGDCCRGKSRLTLCSYGEGGNGFQCPKGYR 80  leaf blotch of barley
Q5DRY5  1 MKFLVLPLSLAFLQIGLVFSTPDRCTHTLCCNGALKAVSECLHAGDSCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYR 80  leaf blotch of barley
Q5DS10 81 QC 82  leaf blotch of barley
Q5DRZ7 81 QC 82  leaf blotch of barley
Q5DRY5 81 QC 82  leaf blotch of barley
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap