Conserved Protein Domain Family
DUF1892

?
pfam08987: DUF1892 
Protein of unknown function (DUF1892)
Members of this family, that are synthesized by Saccharomycetes, adopt a structure consisting of a four-stranded beta-sheet, with strand order beta2-beta1-beta4-beta3, and two alpha-helices, with an overall topology of beta-beta-alpha-beta-beta-alpha. They have no known function.
Statistics
?
PSSM-Id: 370227
View PSSM: pfam08987
Aligned: 9 rows
Threshold Bit Score: 153.376
Threshold Setting Gi: 342300434
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD24852       4 TNNMYRLMILLEEEIGepdlkdGSIDEATETEtkdvhnsdeeknvKKMHEFIEELILPFGTEELDLLNEWFDKFDEEICI 83  Naumovozyma dai...
Q75FB5         3 TDNFYRMMILLEEPHK------QHSTDGRKIE-------------NASHDFVDELLLPIQVDDLEVLNTWFDKFDEEICI 63  Eremothecium go...
Q6CSE6         4 TENVYRMLILLEEPIS------ESAGDTKKKQ-------------NATHEFVDELPLPIQVDEMDLLNSWFDKFDEKICI 64  Kluyveromyces l...
CCC68194       3 KDNMYRMLVLLEEEMEepelfdNDTTDSKATEp------------KKTHEFIEELLLPFEVSELDALNKWFDKFDEEICI 70  Naumovozyma cas...
CAR21965       3 DERNYRMLVLVEDVLEqageknEQETKGEGAP-------------KATHEFVDELILPFEIDDMDKLNEWFDKFDADICI 69  Lachancea therm...
CCK71394       5 GDDTYRMLILVEEPLEddvpttEVTSEDGSQPi------------KSTHEYIDELHLPFGLDELDALNEWFDKFDEEICI 72  Kazachstania na...
Q6FP49         1 mSNLYRMMVLLEEPMEe----dITISDSKEEK-------------KVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEICI 63  [Candida] glabrata
XP_002498589   4 PENSYRMLVLLEEPVSgskpedE----------------------KKVHEFMDELVLPFNVDEIDQLNSWFDKFDEQICI 61  Zygosaccharomyc...
XP_001643039   5 AESNYRMLILLEEGMEnl--deEQTQQDRTEEpk---------esKKMHEFVDELVLPFQVDEIDSLNDWFDKFDEEICI 73  Vanderwaltozyma...
CCD24852      84 PNEGHIKYEITSDGLIVLLLDKEI-EDVVGEIKKFIETN 121 Naumovozyma dairenensis CBS 421
Q75FB5        64 PNEGHIKYEISSDGLIVLILDKEI-SEVIGLVRDFVAAN 101 Eremothecium gossypii
Q6CSE6        65 PNEGHIKYEISSDGLIVLILDKSI-EHIVQEVTSFVEQN 102 Kluyveromyces lactis
CCC68194      71 PNEGHIKYEISSDGLIVLLLDKEI-ENVISEVKKFIDDN 108 Naumovozyma castellii CBS 4309
CAR21965      70 PNEGFIKYEISSDGLVVLLLDRSK-EDVVAQVRKFVEAE 107 Lachancea thermotolerans CBS 6340
CCK71394      73 PNEGHIKYEISSDGLIVLMLGKEI-EHVYEQIKSFIETH 110 Kazachstania naganishii CBS 8797
Q6FP49        64 PNEGHIKYEITSDGLIVLILDKELgEEFVGKVKTFVEQN 102 [Candida] glabrata
XP_002498589  62 PNEGHIKYEITSDGIIVLILDKEM-EPLVSQVRSFVEKH 99  Zygosaccharomyces rouxii
XP_001643039  74 PNEGHIKYEITSDGIIVLILDKEI-ENVLDKVKEFVQSN 111 Vanderwaltozyma polyspora DSM 70294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap