1W9Z


Conserved Protein Domain Family
Reoviridae_Vp9

?
pfam08978: Reoviridae_Vp9 
Click on image for an interactive view with Cn3D
Reoviridae VP9
This domain is found in various VP9 viral outer-coat proteins. It has no known function.
Statistics
?
PSSM-Id: 401069
View PSSM: pfam08978
Aligned: 2 rows
Threshold Bit Score: 474.533
Threshold Setting Gi: 66360328
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W9Z_A   1 MLSETELRALKKLSTTTSRVVGDSTLALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAW 80  Banna virus
Q9YWP1   1 MISDAVVRGFKRLALETERTAGEQTKELGSKVKLSKGEVEYLAVTKDELLEGLRQCNLKKVEQLNLDATFNGNLARAGAY 80  Banna virus
1W9Z_A  81 LFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVlANPYSNKGSGLFITYEHNLISNQIETG 160 Banna virus
Q9YWP1  81 KFIKHSMLIFMTRPIAVSNNEKYSTDVAGIPRSTTNVMVGERMIMKTVPRGT-GSPWSGQCASLIITNGISLHDSVVIPG 159 Banna virus
1W9Z_A 161 KVCVLFITSLsTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTT 240 Banna virus
Q9YWP1 160 SIYVLFQTSL-TTYNKSNSYAYSYCVIPHSKWDPKKIKLTSETSCPSLNSMQSLANSILEGDRAPVTGLYVDIEGVTVST 238 Banna virus
1W9Z_A 241 SASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALS 280 Banna virus
Q9YWP1 239 SNSLSTLPITNVANNYPICFEACVRYVEQVSEINLLYTLA 278 Banna virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap