5D67


Conserved Protein Domain Family
EF-hand_11

?
pfam08976: EF-hand_11 
Click on image for an interactive view with Cn3D
EF-hand domain
This domain is found predominantly in DJ binding proteins.
Statistics
?
PSSM-Id: 401068
View PSSM: pfam08976
Aligned: 2 rows
Threshold Bit Score: 188.772
Threshold Setting Gi: 924443675
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5D67_C    2 ATADRDILARLHKAVTSHYHAITQEFENFDTXKTNTISREEFRAICNRRVQILTDEQFGRLWNEXPVNAKGRLKYPDFLS 81   human
Q6P1E8 1177 ETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLS 1256 house mouse
5D67_C   82 RFSSE-TAATPXATGD---SAVAQR 102  human
Q6P1E8 1257 KLSIErVPSPPMAAGDsgeSTMAQR 1281 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap