1RRZ


Conserved Protein Domain Family
GlgS

?
pfam08971: GlgS 
Click on image for an interactive view with Cn3D
Glycogen synthesis protein
Members of this family are involved in glycogen synthesis in Enterobacteria. The structure of the polypeptide chain comprises a bundle of two parallel amphipathic helices, alpha-1 and alpha-3, and a short hydrophobic helix alpha-2 sandwiched between them.
Statistics
?
PSSM-Id: 401064
View PSSM: pfam08971
Aligned: 3 rows
Threshold Bit Score: 122.403
Threshold Setting Gi: 386922716
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RRZ_A              22 DHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQARELELE 85  Escherichia coli
goetting:EBL_c05450  3 NNALYSLENFDFLARTFARMHNQGRRVDINAVTGNMDEAHRQWFCKRYALYCRKEATVKSVALE 66  Shimwellia blattae DSM 44...
wugsc:CKO_04437      5 DKNVYSLNNFDFLARSFARMQAEGHPVDIQAVTGNMDEAHRSWFCKRYALYCQQATQAKKLELE 68  Citrobacter koseri ATCC B...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap