2ATZ


Conserved Protein Domain Family
DUF1882

?
pfam08966: DUF1882 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1882)
This domain is found in a set of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 401062
View PSSM: pfam08966
Aligned: 12 rows
Threshold Bit Score: 94.7268
Threshold Setting Gi: 151423933
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ATZ_A           2 TEXELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNAXLTSSLIQKHLKREIEIAHNLILRND-KVEN 73  Helicobacter pylori ...
Q7MSV0           3 SEMDLKLIKMIESHYWVKKEGIGQRVLFNGRTFYNKFERVDAPLTRSVIAQHLKGEITVAHSLINDRD-KVEN 74  Wolinella succinogenes
EES90005         3 TDMDLKLIKMITTHYWIKEPGIGQKIHHNGRIFYDKFKRVDEPLTRTILQSHFKKEITVAHSLVNSQE-KVEN 74  Helicobacter canaden...
Q7VFL2           2 TEMDLKLIKMDTSHYYKRVSGLGTKVSHMGRILYDKYERVDAMLTSMLINKHFRKEIVIAHSLLLAKGaKVEN 74  Helicobacter hepaticus
CCB79190         2 TEMDLKLIKMQTSHYFELKPGLGQRVTHLGRCYYDKFERVDASLSSTLIQKHWKKEITIAHGLILADN-KVEN 73  Helicobacter bizzoze...
CBY83382         2 VEMDLQLIKMQTSHYYLKQSGLGERVTYLGRCYYDKFERVDATLTSMLIQKHWRKEITLAHNLILPNN-KVEN 73  Helicobacter felis A...
BAF71436         2 KVFDLEL---NDGHYYIKRKTIVEKIHFDNRTFYAKFELIEESLTPLLLTQHLNRQYTIAAPLLNEGG---LT 68  Sulfurovum sp. NBC37-1
Q30R28           2 TASDLNLIKMSTDHYWIKRDSVVDKIIFKGRTFYNKFEKVNAILSQAVINQHIKGEITVAHSLINKHG-KVEN 73  Sulfurimonas denitri...
WP_013327205     2 TAMDLKLIKMVSDHYWIKRDTVVNKITFKGRTFYNKFEKVNAPLNQSVINKHIKGEITVAHSVVDKKG-IVEN 73  Sulfurimonas autotro...
WP_012856376     2 YTMDVSLIKMITDHYWIKRDAIVQKIDFGGRVFFDKFERIDQPLSNSIIKDHLDGKITVAHSLINRFD-KVEN 73  Sulfurospirillum del...
Q0PBA7           3 SPMDMSLIKIIGDHYYIRRDKIVNKITHRGRLFFDKFERVDAPLNLNVMREHAAKKIVVAHDLITKDN-KVEN 74  Campylobacter jejuni
tigr:NAMH_0899   3 ytVDISLIKMNKSYYYEYKGTIVNKIVYKGRTFFDKYEKINKPLTYQIMNDHAEKKIIVAHDLINRQRnIVEN 75  Nautilia profundicol...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap