Conserved Protein Domain Family
NRBF2

?
pfam08961: NRBF2 
Nuclear receptor-binding factor 2, autophagy regulator
NRBF2 plays an essential role in autophagy, the cellular pathway that degrades long-lived proteins and other cytoplasmic contents through lysosomes. NRBF2 binds Atg14L - a Beclin-binding protein - directly via the MIT domain and enhances Atg14L-linked Vps34 kinase (a class III phosphatidylinositol-3 kinase) activity and autophagy induction.
Statistics
?
PSSM-Id: 401057
View PSSM: pfam08961
Aligned: 9 rows
Threshold Bit Score: 230.9
Threshold Setting Gi: 542192110
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008112965  95 AMDRDGVTHPQASSKPSAEE-SDDQSvaAPASLKYSPSPEKDLQAKLSVLDRDPDTLLFLLQKRK----E-PQEACVRSK 168 green anole
XP_005997767  92 STDLDMTTHLQSLPKVFAEE-ADGKKvlRSSNERYSPVKEQYLRKMQYVFDRDPDTLLFLLENRE----V-QTEACQGSK 165 coelacanth
Q0VFU5        92 VAERELSAHLQASYRSAADN-ADSQNtlGSAGQKSGSNPGKYVQDIPSVLDREPDSLMYLLQRRK----E-PMETCKVSK 165 tropical clawed...
XP_005471288 112 FSKPPSTGSSRPNASPGASA-AELGS----------------------VGEREYDTLLYQLQTRQtggtQiLTPVCSGSK 168 Nile tilapia
1_pfamImport   1 LTQTQSAGQLQPLGPPGLSA-AEGAG----------------------SREREYDTLLFQLQTRQtggcQrSTPPCPGSK 57 
XP_012429874 108 SADKEAATHLQTSYKPSAED-SDDQNvlVPVAQKYSSSTEKHSQDIRGVFDRDPDTLLFLLQKKK----E-PVEACIGSK 181 zebra finch
XP_507815     89 NTDKDAAAHLQTSHKPSAED-AEGQS---PLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKS----E-PAEPCIGSK 159 chimpanzee
XP_001510735 148 TTDREAAGPLQASPKAPADD-AEGPA--GPRIPRRSPSMERRLPEIQGIFDRDPDTLLFLLQKRK----E-PTETCIGSR 219 platypus
XP_007478332  89 TPD--GTPHLLTSCKPSAEDgSEGPS--GPRPQLLSPAPERLSPAVPGVFDRDPDTLLFLLQKRK----D-PTEPCTVSK 159 gray short-tail...
XP_008112965 169 TPKDDKTKMEEQATKIALLERHVEVLLAENERLRQENKQLKAERARLLKSPLEKELDVDADFVEKSELWGLQQHSETaaA 248 green anole
XP_005997767 166 APKDDKTRIEEQETKIAELKRLVELLLAENERLMKENHRLKGENARLQKVPIEKELDVDADFVEKSELWALPQSSKSp-T 244 coelacanth
Q0VFU5       166 APKDDKTKLEEQATTIKELNQLVDTLLAENEALRKENKKLRAEVARLQKNP-EKDLDIDTDFVEKSELWNLQQPTGSa-A 243 tropical clawed...
XP_005471288 169 TTKDDKTRLEEQQTTIENLRLLVDNLTNENQRLRAENERLRLENMRLHSEA--------ADFVERSELWVLPQAGG---P 237 Nile tilapia
1_pfamImport  58 TAKDDKTRLEEQQTTIIDLRRLVDHLMDENERLASDNKQLQSENGRLRAEAVEA-----VDFVERSELWVLPQAGG---A 129
XP_012429874 182 APKDDKTIIEEQATKIADLKQLIESLVAENERLRRENKQLKAERARLQKSPVDKELDVDTDFVEKSELWGLQQHSES--A 259 zebra finch
XP_507815    160 APKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHSET--A 237 chimpanzee
XP_001510735 220 APKDDKTIIEEQATQIEDLKRHVEFLVAENDRLRRENRQLKADKARLQKAPRDKELEGDADFVEKSELWGLQPQSEM--A 297 platypus
XP_007478332 160 APKDDKTIIEEQATKIADLKRHVEFLVADNERLRRENKQLRAEKARLQKAPLEKELDVDADFVEKSELWSLPPPTET--A 237 gray short-tail...
XP_008112965 249 TSASSWQKF-TSSAGKAKDIPIPSLPPLDIPSPE------LPLLELSEDILKGL 295 green anole
XP_005997767 245 STAPTWQNL-TGEAGKAKDIVVLNLPPLDIPLPD------LPPLELPEDIQCDL 291 coelacanth
Q0VFU5       244 NPTSAWQKF-VAHSGKGTDIPIPNLPPLDIPLPE------LPPLELPEDIQSQL 290 tropical clawed frog
XP_005471288 238 MGTGVGQG--GESKRKGKEIAIPQLPPLEMPAQEdlclddLPPLELPEDIQNEL 289 Nile tilapia
1_pfamImport 130 MGTGSGQE--RKGTGKGKEIAIPQLPPLEMPAREdlglddLPPLELPEDIKHEL 181
XP_012429874 260 SSAATWQKF-ATTAGKAKDIPIPNLPPLDIPSPE------LPLLELSDDILKGL 306 zebra finch
XP_507815    238 TASSTWQKF-AANTGKAKDIPIPNLPPLDFPSPE------LPLMELSEDILKGF 284 chimpanzee
XP_001510735 298 TASSTWQKFaAANTGKAKDIPIPNLPPLDFPSPE------LPLLELSEDILKGL 345 platypus
XP_007478332 238 SSASAWPEF-AANTGKAKDIPIPNLPPLDFPSPE------LPLLELPEDILKGL 284 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap