2AUH


Conserved Protein Domain Family
BPS

?
pfam08947: BPS 
BPS (Between PH and SH2)
The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor.
Statistics
?
PSSM-Id: 401046
View PSSM: pfam08947
Aligned: 9 rows
Threshold Bit Score: 83.3778
Threshold Setting Gi: 82407900
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AUH_B        10 SISENSLVAMDFSGQK-SRVIENPTEALSVAVEEGLAWRKKGSLRL 54 
AAH21820      37 SVSENSLVAMDFSGEK-SRVIDNPTEALSVAVEEGLAWRKKGCLRL 81  house mouse
NP_001102563 266 SVSENSLVAMDFSGQI-GRVIDNPAEAQSAALEEGHAWRKRST-RM 309 Norway rat
XP_015217421 372 CVSEASLVAMDFSGKAgGRVIENPREAQSAEQEEGQAWRKKTALRC 417 spotted gar
XP_017828620 366 SVSDNTLVAMDFSGHA-GRVIENPREALSVALEEAQAWRKKTNHRL 410 white-tufted-ear marmoset
XP_014329009 335 SESENSLVAMDFTGKAgGRIIENPTEAQNAEQEEAQAWRKRETLRF 380 southern platyfish
POI24631     316 SVSDSALVAMDFSGCT-GRVIENPSEVLTAVLEEAQAWRKKTTHRY 360 Chinese bamboo-partridge
TNM93282     264 SVSENSLVAMDFSGRT-GRVIDNPVEAQSAALEEGQTWR-KRSQRM 307 Takifugu bimaculatus
XP_004917759 282 SISENSLVAMDFSGQK-SRVIENPTEALSIALQEGLLWRRKSSGRI 326 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap