6GPE


Conserved Protein Domain Family
CsiD

?
pfam08943: CsiD 
Click on image for an interactive view with Cn3D
CsiD
This family consists of various bacterial proteins pertaining to the non-haem Fe(II)-dependent oxygenase family. Exact function is unknown, but a putative role includes involvement in the control of utilisation of gamma-aminobutyric acid.
Statistics
?
PSSM-Id: 401042
View PSSM: pfam08943
Aligned: 14 rows
Threshold Bit Score: 502.223
Threshold Setting Gi: 123513640
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GPE_A               41 FTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVAKILDDLCANQLQPLLLKTLLNRAEGALLINA- 119 Escheric...
Q47V67               17 FSVAPFAANPRLQVIKLSSETVKGFIEQALPLGVQAIEYKPFLRFHVAGILNHLTNDTLGALLLGIIKNRDTGAFMLQC- 95  Colwelli...
JLExeter:vfu_B01320  16 FTVQPHPTNPRLQVVTLARSLLEKFNDLTCEWDLQSIEYKPFLRFAVADALDKASDYQLGSLLKRIIDDRDQGAFLLEAd 95  Vibrio f...
WP_014644427         19 YSIQPHPKHNRLYHIEFEEQVIDQFLQEVQAISDEQLEYIPYQRFITANILLNLVDQDFGNTIRTLLHDRNSGGFTVGL- 97  Halobaci...
Q2KU12               13 gTVSDHQTHTRVRQVTLESEGLERFLDQARAIDVQNLEYVPFMRFKLADMLLQACGEGLRATLNALVEDRRHGGFTIGL- 91  Bordetel...
CAS:CtCNB1_3674      15 YEIAAHPEHPRLLKLTLNTDALNAFLADVRDIDVQNLEYVPFMRFHLARRLKAHMGVDFGETLVNIIRDRKHGGFVLGL- 93  Comamona...
bosiu:SAR11G3_00795   6 lFIENHPTSDRLYDVKIENKYLDKIKDQFDVFDLLDIEYKPFLRFHITDIFNKIFDSKIQNFVKETIQDRQRGAFIIGP- 84  Candidat...
WP_014291194         17 FSLAPAAQSDRLLELRFDENTVNAFLKATAEWPIQALEYKSFLRFRVAQVLNDLCGQALQPLLINTLVDRNTGALLITP- 95  Oceanimo...
Q1QW11               73 FTLEASPQSSRLLALTFDEATVAAFREATAEWPVQALEYKSMLRFRVAKILDDLCANTLQPLLVETMTDRGTGGIVVNP- 151 Chromoha...
ABM04446             11 FTVTPHTENSRLQVVIIKKATLENFIENTRDFGLQAVEYKPFLRYAVADKLDQACNYELGKLLNEIMQDRDRAAFLLEAd 90  Psychrom...
6GPE_A              120 VGVD-DVKQAD----EMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVL 194 Escheric...
Q47V67               96 EPVAaEFDQLE----FNILLSTAVSHLIGVPNLDAMYGKFYARFSVKNEDNSDSYLRQAHRRMELHNDGTYVEERTDWVI 171 Colwelli...
JLExeter:vfu_B01320  96 KDVQaEFEDTEtqrrYFVKLSTAISHLIGLPNFDAMYGKYYARFTVKNVDNSDSYLRQAHRRMELHNDGTYVNERTDFVL 175 Vibrio f...
WP_014644427         98 QGRT---EDAQ----DYVKFSTALSHLAGIPNFDAMSKKYYARFSVKHTDDSDSYLRQAYRRFTLHTDGTYVDEPTDWLL 170 Halobaci...
Q2KU12               92 QGLS---ADPD----DFVRFGTAVGYLLGPANHDSMSGKYYARFLVKHTDNSDSYLRQAYRLFTMHTDGTYVTEATDWLL 164 Bordetel...
CAS:CtCNB1_3674      94 EGVS---QDSD----DYVKFGTAIGHILGPANHDSMSNKYYARFLVKHTDASDSYLRQAYRLFTMHTDGTFVTEATDWLL 166 Comamona...
bosiu:SAR11G3_00795  85 ETMDsKKYDAD----FLVKVSTALTHLIGTPNFDSMAGNYYARFEVKHTDNSDSYLRKAYKKLDLHTDGTFVKEKTDWLL 160 Candidat...
WP_014291194         96 EGLN-QVEQAE----DMVKFTTAVAHLFGRSNFDAMSGQYYARFVVQNQDNSDSYLRQAHRVMELHNDGTFVEQDTDYVL 170 Oceanimo...
Q1QW11              152 QGLD-DVAQAD----DMVKFATAVAHCMGRSNFDAMSGQYYARFVVQNVDTSDSYLRQPHRVMELHNDGTFVEQDTDYVL 226 Chromoha...
ABM04446             91 ESAQaDFIDSDeqrdFFVILSTAVSHLIGLPNFDSMYGKYYARFTVVNEDNSDSYLRQPHRRMELHNDGTYVDERTDFVL 170 Psychrom...
6GPE_A              195 MMKIDEQNMQGGNSLLLHLDDWEHLDNYFRHPLARRPMRFAAPPSKNVSKDVFHPV-FDVDQQGRPVMRYIDQFVQPKDF 273 Escheric...
Q47V67              172 MQKIAEENMAGGDSLLLHVDEWQDLEKFYNHPLAKEDIQWTSPASKNITYKMQHPVfFEEDDNGRPKMLFIDQFAEPLNM 251 Colwelli...
JLExeter:vfu_B01320 176 MMKMHESHMEGGDSLLLHLDDWQDLGKFYNHPMAKQDITWGAPPSKNTGYDIAHPVfFEEDADGKPHMLFIDQFAKPKNV 255 Vibrio f...
WP_014644427        171 MMKMEEENAVGGSSRLLHLDEWEEFDYFYNQPLASYPFTYKAPASKNVSEDVQRKPfY--EWNNGPCICFIDQFVFPETI 248 Halobaci...
Q2KU12              165 MMKFDERNAVGGESRFLHLDDWADLDRFTQDPLATQPLLYKSPASKNVAEQVERPLfF--QSRYGLSVCFIDQFVQPATL 242 Bordetel...
CAS:CtCNB1_3674     167 MMKFDEQNAVGGESRFLHLDDWSELDCFVQDPLGAKPLLYKAPGSKNVNERVERPVfF--HGEFGLSISFIDQFVQPAND 244 Comamona...
bosiu:SAR11G3_00795 161 MMKMKEENANGGESVLLHLDDWEDLKDFIKDPVAKQNFIWGSPKSKNIDYKLEHPV-FSKDMNGKPTISYIDQFPEPSSL 239 Candidat...
WP_014291194        171 MLKIDEQNMEGGNSLLLHLDDWEHLDRFYADPMARRVMRWAAPPSKNTTKDVYHAV-FDTDRSGKPIMSYIDQFVQPKNY 249 Oceanimo...
Q1QW11              227 MMKIDEQHMEGGDSLLLHLDDWADLERFYTHPLARRDMRWAAPPSKNVSHDVYHPV-FGVDAEGRPVMSYIDQFVQPRDF 305 Chromoha...
ABM04446            171 MMKMDEKNMEMGDSLLLHIDDWKDLPHFYNHPLAKQDIVWTTPPSKNINYQIEHPIfFEEDKNGKPHMLFIDQFACPQRM 250 Psychrom...
6GPE_A              274 EEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYF 334 Escherichia coli K-12
Q47V67              252 RQGQYLYEMGTSLEAEQNTFNVRVPVGSMLVVNNHAWLHGRDKFVADKGLYRELLRQRGAY 312 Colwellia psychrerythraea 34H
JLExeter:vfu_B01320 256 REGLYLYEMGESLEHDPACFNVRVNVGSMLVIHNHRWLHGRDKFVPHPELSRELLRQRGYF 316 Vibrio furnissii NCTC 11218
WP_014644427        249 AQAQYLKELSQSMENSKGVIELELPVGDLVMLNNRFWLHGRAGFEENPDLHRELLRQRGHF 309 Halobacillus halophilus
Q2KU12              243 EEALYLHDLSASMESSAGVQEITLPPGELVVLNNYFYLHGRAPFEKNEALHRELMRIRGLF 303 Bordetella avium 197N
CAS:CtCNB1_3674     245 AEAEYLQNLSESMENSPGTRTVSLPAGDLVVLNNYFYVHGRAPFERNEQLHRELMRQRGTF 305 Comamonas thiooxydans
bosiu:SAR11G3_00795 240 EQGLFLNRLSESLENSKRHMAFKLPPGYSIFSNNHFLLHGRKAFQPSPNMTRELLRQRGIF 300 Candidatus Pelagibacter sp....
WP_014291194        250 EEGVWLADLSDAIETSTKQLSVRVPTGSFLLINNHFWLHGRDKFIAHDGLRRELMRQRGYF 310 Oceanimonas sp. GK1
Q1QW11              306 EEGNWLCELSESLESCEARLSVPVPVGSFLLINNHFWLHGRDRFTPHPELRRELMRQRGYF 366 Chromohalobacter salexigens...
ABM04446            251 QEGLYLHQMSESLENESNCFNIRVKTGAMLVAQNHCWLHGRDKFISNPGLKRELLRQRGHF 311 Psychromonas ingrahamii 37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap