2G6T


Conserved Protein Domain Family
DUF1919

?
pfam08942: DUF1919 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1919)
This domain has no known function. It is found in various hypothetical and putative bacterial proteins.
Statistics
?
PSSM-Id: 401041
View PSSM: pfam08942
Aligned: 10 rows
Threshold Bit Score: 225.325
Threshold Setting Gi: 93279889
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2G6T_B                95 FISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHN-DDYIKFLENXDYYLEQELK----VEQEGN- 168 Clostri...
CDM69222              16 RRNEIVKGYKEKLINKDFTILSSNCNGGFIMHDLGVRFNTPTINLFFLP-KDFIKFVKDFDKYINLELIe---VEDCKE- 90  Clostri...
P44134                15 QRFFINRTLQRKLTNQGMTVISANCVGAFILHDLHQPFNSPFVNLYLSP-QDFLRYLQNIDFYLTQPLTf---V-QTEK- 88  Haemoph...
WP_012072871          13 FRPAINKRLRRRLKNHRMSVIAGNCNGALILHDLQQQFRSPFVNLYLEP-ADFIRYLQNPRHYQQAELVf---E-QTDK- 86  Actinob...
Q65UI3                20 FRRSINRKNQRLLTNHEMSVIASNCNGAFILHDLAEQFRSPFVNLYLEP-ADFVKYLQNIHHYMQADLQf---I-KTDK- 93  [Mannhe...
ABM02191              10 EKYIKSRLSRLKLKQNDFTIISNNCWGTFMYKKFALPYTTPFVNLLIFS-PDYIELLENLTPELLTKISf---IEHENSq 85  Psychro...
Q8DQ80               140 IAAEKGIFPFLELDRLDFTIISNNCVGGLIYKQLGFQYRTPFVGLFILP-DDYYKLTKHFRYYMEQELVf---EEELISp 215 Strepto...
Q97H29                95 FTSNFDFKRYCKLIENPITIISNNCWGGKISNHLGLKFNSPFINLFLEL-DDYMKFLENMDYYLDQELQ----VDDEGD- 168 Clostri...
CDE64695              24 RHSFYRKRLVRRLTNLAPSILSLDCVGGVMAHDLRLRFNSPTVNLFFEScGDFIDYVADLRYYSQAELCecpyAYEGAR- 102 Alistip...
goetting:Cspa_c53530  11 LRKRINMKNSKRLKNKDFSLLASNCNGAFILHDLNLKFNSPTVNLFMYP-SDFVKYIKNLEYYSKCDLKf---IKKEDT- 85  Clostri...
2G6T_B               169 -------------VYsctxPKGSLGtg---dNkIILNFNHQASFAEAKNDWDERKTRINKKNLFVKXlIKDD-NEKLVKR 231 Clostri...
CDM69222              91 -------------TY----PVGKIE------D-IKIYFQHYHTFKEAKEKWDERKRRINKENLFIMAtDRDGcTENDIRE 146 Clostri...
P44134                89 -------------SY----PVGKLA------D-LEIHFMHYHSEQEANEKWQLRTSRMKLDNLFIMMtDRDGvTEKDIQL 144 Haemoph...
WP_012072871          87 -------------PY----PVAKLD------D-IRLYFVHYHCEREAREKWLSRSSRINWDNLFVMTtDRDGcTEQNIAD 142 Actinob...
Q65UI3                94 -------------AY----PVGKLE------D-LTVYFMHYHSEQEARNKWIERTKRINLDNLFILMtDRDGcRYEDLSA 149 [Mannhe...
ABM02191              86 hkeemvrlniykkNY----PIGILD------NkYELHFLHYQSQQDAKDKWLKRLARMNFDKLIVKFsASLKfEDNMAER 155 Psychro...
Q8DQ80               216 sw--------theVY----PLGHLG------D-IDIHFLHYSSIEEARTKWEKRKKRINWNNLYFKFdNKDSaSEEILNK 276 Strepto...
Q97H29               169 -------------VYscdiPKGSLGsg---dNkIIINFNHNASFEEAKNDWERRKKRINRKNLFIKMtLPAN-NEELVKR 231 Clostri...
CDE64695             103 -------------RY----PVGMLKgngtlpD-IKIHFLHYRSFEEAREKWLERSGRLDFDNLCVVM-QAAKlDEGLLER 163 Alistip...
goetting:Cspa_c53530  86 -------------AY----PVGKLD------D-IEIHFMHYKDENEAERKWKERTDRIDFDNMFVMMtDRDGcSLEDLKE 141 Clostri...
2G6T_B               232 FDNLPYKNKVCFHPKPXK-YKSVAFFPRY------IWRCINYAArTSNSNLEQYTXDXSWLE 286 Clostridium acetobutylicum
CDM69222             147 FDRIPYKNKVIFTHKHYEdIESAYQIKGFend-nqVGILSCFEG-ATGKRYIDQFDYVSWLN 206 Clostridium bornimense
P44134               145 FDQLPFKNKVIFTHKPYPaFKSAYYIKGFekq-nqVGDIFEFSG-WNGKKYYDQFDYVKWFN 204 Haemophilus influenzae Rd...
WP_012072871         143 FDALPYPNKVIFTHKAYPqFTSAYYIRGFenq-seVGDLFEFSG-WFGKKYYDQFDYVAWFN 202 Actinobacillus succinogenes
Q65UI3               150 FDKLPFANKIVFTHKKYTeFSSALYIPGFeaq-sqVGDLFEFSG-WNGKKFYDQLDYVNWFN 209 [Mannheimia] succinicipro...
ABM02191             156 FDDLNFKNKICFTATAFPnLKSIVSMQAFkgketvIDEWKHTTK--------KEFDLINFIN 209 Psychromonas ingrahamii 37
Q8DQ80               277 MDNLPYSNKLILVNRPYKnLKSQCVIPGQe----hLPELAIMSD------PLNTFDIMAWLK 328 Streptococcus pneumoniae R6
Q97H29               232 FDNLPYKNKVCFYPRPMK-YKSIVFCPRY------IWKCKNMARkTSNYDLVYFVMDTNWLQ 286 Clostridium acetobutylicum
CDE64695             164 FERLPIPRKVILAYETLP-LQSPSIFKMRsldsfvPGRILDYNG-LSGRRYLDDFDYVAFLN 223 Alistipes putredinis CAG:67
goetting:Cspa_c53530 142 FDKLPYKNKVVFTHKEYSeIKSSVYIKGFene-knVGNLYSYKNrFTGYKYYDDFDYVEWFN 202 Clostridium saccharoperbu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap