1XCR


Conserved Protein Domain Family
DUF1907

?
pfam08925: DUF1907 
Domain of Unknown Function (DUF1907)
The structure of this domain displays an alpha-beta-beta-alpha four layer topology, with an HxHxxxxxxxxxH motif that coordinates a zinc ion, and an acetate anion at a site that likely supports the enzymatic activity of an ester hydrolase.
Statistics
?
PSSM-Id: 401030
View PSSM: pfam08925
Aligned: 53 rows
Threshold Bit Score: 301.792
Threshold Setting Gi: 674574970
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XCR_A               22 QKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI--KLPGAFILGAG 99 
CDS39472             24 REGLKDCFRSVKVNVVPCPDLTASPFGLLRPGLAGKSVVCDVGSMTYLLPVADTSKRYSFCQVIESS--GVCGGQLLGAG 101 Echinoco...
EFN73155             17 QVEFNKFYNEATVKVVNCPDLRKAPFHLVAPGLCGNTALLEVGSLSNLFPFPRMEKKYDFISFLETSgrSNDDNFIIGAS 96  Florida ...
XP_012551475         55 SNGLTTNFKFVEVSVADSPDLTEPPYYLKSPGLTGDAKLVEIGGPPYLVPQVKRDKIYDLAKLLEHL--NRDPAFLAGAG 132 domestic...
OWR52104             29 SQKLPSNFEYVRVSAEESPDLTRSPYNLTSPGLCGDAKLVELGGPPYLVPTVRRDKLYSLTDLLRHL--RRDPALLAGAG 106 Danaus p...
XP_001956724         60 QGALCENFKTVKVKVCPCPDLKAKPFCLVESGLCGNGTLLEVGSPSYLRPLVQRDKLYNIPEIIRRVq-GPGRIFAVGAG 138 Drosophi...
EDX08762             31 QGALDENFQTVDVSVEACPDLRDSQFGLVESGLSGKATLLEAGGPPYLRPLVQRDKLYNLKEITRRAq-GAGKIFAVGPG 109 Drosophi...
WGS:AAQB:GK12404-PA  31 QGALGQNFATVEVSVGACPDLKLPPYGLVESGLGGRPTLLEAGGPPFLRPLVNREKLYNVHEITRKIq-GPGKIFAIGAG 109 Drosophi...
BAH71971             37 lpELLDNFENASVEVVQCPDLTQPPFNLTSEGLCGDENVFDIGDVTNLLPSLKREKLYNVKDLKQIT--GSDPLFIIGAC 114 pea aphid
XP_016657413         35 lpELSNNFETVSVDAVQCPNLTCSPFNLAAEGLNGDEMVIDIGSPSFLLPLVNLNKVYDIRDFAKVT--GTDPLFVIGAG 112 pea aphid
1XCR_A              100 AGPFQTLGFNSEFMPVIQT-ESEHK--PPVNG-----SYFAHV--N----PADGGcLLek-ySEKcHDFQCALLANLFAS 164
CDS39472            102 GGPFFTHGKSCEMAASLQFaNGKIAsnSTLHGvydeqTRTPQVinAt--------------------DNNFGLVGQLLST 161 Echinoco...
EFN73155             97 LYPSSN-GHMGELIMNASFsPLDEEgmRVKNR-----SYVAFL--AqdhtGENVKlDIlndyNR----VKCFLHGNFFIS 164 Florida ...
XP_012551475        133 AGPWPYLGVNCEGIVNLSV-RNGT----VDQG-----TRIVSV--HpvgaPKGSSgYLqqqlPND-E-TRTALLGNYLLT 198 domestic...
OWR52104            107 AGPWPYLGVNCEGIINVYV-KDSA----VSQG-----SHVVSV--SpvgaPKGQSsFVqeklPAS-E-TRTALLGNYLLS 172 Danaus p...
XP_001956724        139 AGPWPIRNSNCEGIFNLSVdKDDQ----LTNG-----SYTATV--R----GESEEcVQek-lPDT-E-PRCALLLNLFLS 200 Drosophi...
EDX08762            110 AGPWPIRHSNCEGIFNFSL-NEED---ELTQG-----SYTATV--R----GANEDcVLer-iPET-E-PRAALILNLFLS 171 Drosophi...
WGS:AAQB:GK12404-PA 110 AGPWPIRNSNCEGIYNLSV-SEDD---ILTNG-----SYTATV--R----GDQEEcVLek-iPNE-E-PRCALMMNLFLS 171 Drosophi...
BAH71971            115 AGPYPFFGADSECVENVKM-TGDR----VENG-----THVHMT--K----SDDVPeCFhkslPDD-E-MRFSMMANFFTS 176 pea aphid
XP_016657413        113 AGPWPHVGVNCEFIGNVRLtSDDSV--NNNNS-----SHLYKV--D----PQTGS-QVhhrlPQD-E-TRFALLANFYTS 176 pea aphid
1XCR_A              165 EGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYG-NK-PIGMGGTFIIQKGKVKSHIM-PaEFSSCPLN--SDEE-VNKW 238
CDS39472            162 EGLPGSVVEVDVAGRLKEGSVYVFLREALTAAYEkLDkPVALGGVFVLTDSKARFHVLqP-NFPPYPVD--TPAR-RAEF 237 Echinoco...
EFN73155            165 EGKPGRVLEIHAKARREDKELTKVIQHTLQKYYEaTStLVGLGGTFVVHNGLVRHHLM-P-DIGQISLEncSDESrIRNW 242 Florida ...
XP_012551475        199 EGKPGKVIKVVAKNRTGKSNFITSIRETLKTHYG-DK-VVGLGGAFVLRAGRGYFHVM-P-DFSRAPLC--SDAA-VDSW 271 domestic...
OWR52104            173 NGEPGMVIKVVAKKRIGEKNFITAIREALKEHYG-DK-VVGLGGTFALLEGRAKHHVM-P-DFSATPLC--SDSD-VDSW 245 Danaus p...
XP_001956724        201 QGLPGEVIGILVKQRICEKNFVDCIRKGLLEHYC-DR-VVGLGGIFVIKRGCVHQHVM-R-DFSKTPLE--SEED-VNKW 273 Drosophi...
EDX08762            172 EGKPGEVLRISAKQRTGGENFVECIRKGLERHYG-DQ-VVGLGGIFVVRRGCVHQHVM-R-DFSKTPIH--TQEQ-IQNW 244 Drosophi...
WGS:AAQB:GK12404-PA 172 QGLPGDVLHIKAKCRTGEKNFIDAIRQGLEEHYGnER-IIGLGGLFLVKTGLVHQHVM-R-DFSKTPIT--TPEQ-VKQW 245 Drosophi...
BAH71971            177 NGFKGEVLKIVCEVRKGPLSYSTCIKEALVKHFG-NE-IIALGGVILIENGKVKVHVIkP-SLTKIPIK--SEKE-LGNL 250 pea aphid
XP_016657413        177 RGMTGEVLKIVCETRNGPLDFVTSIRKALAKYFG-DK-PVGLGGVILIETSKVKVHVM-P-DFSKIPLD--SEAD-LNNW 249 pea aphid
1XCR_A              239 LHFYEMKAPLVCLPVFVSRDP------------GFDLRLEHTHFFS----RHGE--GGHYHYDT-TPDIVEYLGYFLPAE 299
CDS39472            238 IKIFEMDPPVLGMGTLVSHDPy-----------GIDLKLEHFHCYN-----EAKtlAGHFYWDT-DPEKAHYRLYLTAAK 300 Echinoco...
EFN73155            243 VKTRILTTPLVAVGTIVNKSSfpvvltnsklqtDLQLTTNHFHSFS-----FEPlvGGHYYTNVeYGNSAEYLGYFCPAK 317 Florida ...
XP_012551475        272 LHYFELDAPLTVVGTLVTGDL------------GLDLRVQHFHGFSggggGAGA--GGHYHYDT-TPEDVHYEGYFTVAS 336 domestic...
OWR52104            246 LHYFEHSAPLAHVGTLVTGDL------------GLDLRVQHFHGVS----EHGQ--GGHYHYDT-TPLAAHYEGYFTVAG 306 Danaus p...
XP_001956724        274 LKFYEMPAQLNCLGTLVTKDL------------DLDLRLEHFHSFS----FSNW--GGHYHYDT-TPDSVEYEAYLNVAE 334 Drosophi...
EDX08762            245 LKFYEMPAQLNAVGTLVTKDM------------GLDLRLQHFHSFS----FANW--GGHYHYDT-TPDTVEYEAYLNVAE 305 Drosophi...
WGS:AAQB:GK12404-PA 246 LKFYEMPAQLNAVGTLVTKDY------------GLDLRLQHFHSFS----FSNW--GGHYHYDT-TPDIVEYEAYLNVAE 306 Drosophi...
BAH71971            251 LHFIELSPPLVGVGCIVSHDP------------GLNLRLQHFHLYT----DHNQ--GGHYYNDT-EPETIKYTGYFGVSK 311 pea aphid
XP_016657413        250 LKFFEVSTPLVALGYLVSHDP------------GLDLRPQHFHLFG----NHGE--GGHYHHDT-EPTTVKYTAYLNVAK 310 pea aphid
1XCR_A              300 FLYRI 304
CDS39472            301 SLLRI 305 Echinococcus multilocularis
EFN73155            318 KLYRL 322 Florida carpenter ant
XP_012551475        337 SLIRV 341 domestic silkworm
OWR52104            307 SVIRV 311 Danaus plexippus plexippus
XP_001956724        335 RVLRV 339 Drosophila ananassae
EDX08762            306 RVIRV 310 Drosophila simulans
WGS:AAQB:GK12404-PA 307 RIVRV 311 Drosophila willistoni
BAH71971            312 QFTKi 316 pea aphid
XP_016657413        311 KLIRV 315 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap