Conserved Protein Domain Family
DUF1851

?
pfam08906: DUF1851 
Domain of unknown function (DUF1851)
This domain is found at the C-terminus of a variety of proteins that are functionally uncharacterized.
Statistics
?
PSSM-Id: 401014
View PSSM: pfam08906
Aligned: 21 rows
Threshold Bit Score: 73.8279
Threshold Setting Gi: 524117092
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCO10738       107 MKFFLQALSEENsvFLSDYLNSDQYFLALEKYGEVQYEEAFGYVPLLGLGGSEKIENLDKVKIKKYIFLISQLV 180 Carnobacterium malt...
ADO55783       107 FEFFFSDLEDDS--SLQNDLDWLPYPDAIEKYGKPAFDECFGYVPLLGLGGSEKIENLEKVKLIEHIYLNTQFT 178 Paenibacillus polym...
BAK15744       109 YSLFLRFLEEEA--FRQKALDWLPYPEAIEKYNEPEYDDCFGYTPLLGLGGAEKVENLKKVKLKEHIRIITEFM 180 Solibacillus silves...
CAZ97370       133 LQSFFEDFLTNEe-DREEWLRETLFKQAIAEQGHLAKNEVFTFTPILALGGAMETKYLKKGNAQVYQDIVFQMT 205 Zobellia galactaniv...
Q2SGS6          68 YEEFKIKLQDNE--LLNEWFLVPLVLQLKEQGSVLERGKLYGFKRLPVLGGKYEPENFELTDIEIHFALSGQMN 139 Hahella chejuensis ...
jgi:AciX8_1297  70 RDHFAIQLDEEE--NASNWFMIQLVDGCVAAGLKLEPNQCYGYKIPPILGGKYTIENVVPLNLSEHYSFLAGIy 141 Granulicella mallen...
Q01SI6          67 RKRFAELMNIPK--NANNWLAIPLVDRCVAAGLVLGAGQCYGYKDPPLMGGEYSVENVTTVDLAEYYAVLAGVW 138 Candidatus Solibact...
WP_012910644    69 EDQFLDLLEDPD--NAAEWLMYPLVDMATAAGMTLENGECFGYEELPVLGGEYDTANIAIYALDSYWKFCGDMH 140 Pirellula staleyi
jgi:Psta_2086   69 VDDFKQKMVQKE--NANTWFQPQLVGSILSQGKQLSAGEVFSPSVPLVLGGSLEADNFEATDMQVHFGMLGQIH 140 Pirellula staleyi D...
CCY90741       100 IDELFDEAFNHPs-IKSGLLQEEKFKKITSLFGYLKYGEAFILKPWILLGGTDKPENYVIGNLSTYLDLVSQtl 172 Eubacterium sp. CAG...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap