Conserved Protein Domain Family
DUF1841

?
pfam08897: DUF1841 
Domain of unknown function (DUF1841)
This family of proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 401006
View PSSM: pfam08897
Aligned: 66 rows
Threshold Bit Score: 192.385
Threshold Setting Gi: 340555304
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESQ14824                 5 DRTALRRVYIDAWRKAQAGEPLQPLEQQLTEIIQRHPEYHGLLDAGVDALDRDWLPEQGESNPFLHMSLHSAVLEQVTAD 84  uncul...
CAS:Atc_0407             1 -------MFIDQWQRYRRGLPLDGIGQRIVAVVLEHPEYHALLDDPDKALAADFSPLQGETNPFAHMGLHVALLELLANA 73  Acidi...
WP_012823945             5 DRRQMRQPFLDAWKKQREGLPMTGLELKISEVIGQHPEYHELMSDPERALEKDWLPENGETNPFLHLGFHLSIREMVEID 84  Halot...
PRJNA52553:THIAE_06685   5 ERDKLRQHYADIWQKARANQPLDALEQQIALVIEQHPEYHKMLENRQ-HIKNEYLPEMGETNPFLHMGMHLGIREQVATD 83  Thiom...
Q31H12                  30 ERDKMRQFYVETWQKATQNQPMDAMETMVARVIEMHPEYHMMLTNEK-HLGNDYLPELGETNPFLHMGMHLGLQEQVALD 108 Hydro...
Q5NH27                   6 DRYQLRKLFIDSWNKFVNNTPLTALEEQIARIIELHPEYHKQITLEN--IDKDYLPEVGQINPFLHISLHLAIIEQIQTN 83  Franc...
WP_014703685             5 DRDSLRRYYHDVWHKWQHQQPLTMLEQQIAVVIQEHPEYHSTLSHKQ-SVQQNYFVESGDNNPYLHLGLHLAIREQVATD 83  Methy...
WP_025386663             6 eVRDTRQLFFSSWKKYRERQPLLPLEEQIAAVILDHPEYHGLLEHRF-ASEASYFPETGQTNPFLHMGLHLAIRDQIATD 84  Legio...
Q5ZRI0                   6 tVQETRQLFFISWNKYQNKKELSPLEKEIAQVILDHPEYHKVIEQIPSFPEHTYYPELGETNPFLHMGLHLAVREQVATD 85  Legio...
WP_003633554             6 tiQDTRQMFFSSWEKFQQKKLLSPLENEIVQVILAHPEYHKILENQDKFQQQSYLPEQGEPNPFLHMGLHLAIREQVTTN 85  Legio...
ESQ14824                85 RPPGIRALYQRMIqHCLGDVHEAEHRLMDCLAEIMWQAQRDGREPDPAALLRCINS 140 uncultured Thiohalocapsa sp. ...
CAS:Atc_0407            74 EPPGIVEAFAGL--TERLERHPAEHAFVECLGELIWQGQRAGRQPDLADLLPCVRR 127 Acidithiobacillus caldus SM-1
WP_012823945            85 QPPGFRQKYQDLC-RKTGDLLRAEHQIMECLSEALWRAQRDGTEPDGTALLRCMAd 139 Halothiobacillus neapolitanus
PRJNA52553:THIAE_06685  84 RPAGIAQVHRVLS-LKLGSVLEAEHAMMECLAEALWQSQKNQQAPDELAYQACLMQ 138 Thiomicrospira aerophila AL3
Q31H12                 109 RPTGIQALYQQLG-NQIGDVHETEHAMMDCLGEALWQSQQQQGLPDEEAYLSCLKN 163 Hydrogenovibrio crunogenus XCL-2
Q5NH27                  84 RPFGISNVYQQLLgKYNNDEHKVHHIMIDYLAEEMWKSQKYNTLPDEQNYLTKLQE 139 Francisella tularensis subsp....
WP_014703685            84 RPAGIRHVYQKLLaQHQGNQLDTEHQMMDCLAECIWQSQRSNQSPDETAYLAALQt 139 Methylophaga frappieri
WP_025386663            85 RPAGIEAIYKNLL-KKYAEPLVVEHLLMDHLAECLWQAQRHHALPDEKKYLEACAq 139 Legionella
Q5ZRI0                  86 RPQGIRTVYTKLI-EKYQDPMAVEHLIMDQLAECLWLSQKNNRPPDENHYLITLQN 140 Legionella pneumophila subsp....
WP_003633554            86 RPVGISAIYTKLI-QKYNDPMTVEHLLMEQLAEFLWLAQKNNLPPDEALYLRTLAN 140 Legionella longbeachae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap