Conserved Protein Domain Family
DUF1839

?
pfam08893: DUF1839 
Domain of unknown function (DUF1839)
This family of proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 401003
View PSSM: pfam08893
Aligned: 20 rows
Threshold Bit Score: 390.523
Threshold Setting Gi: 183581914
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAG30385                39 RRSVLHDPAEPWSPTNCYMDVWIGLTAVLGLDPVPMLGAAFSADFLGDQWEFLKPRQEDLECLYGLTVGEYDTWRPLGEH 118 Kocur...
jgi:Gbro_1075           22 QPHAAHAPDRIWQETNCYLDLWIEVLHALGHDPVPSFVCALSADHDGAQWSFLKPAPEDLRTMYGLEVAEETLWRPVLDT 101 Gordo...
PRJNA231235:Y013_13430  14 SPHFVHAADRIWTETNCYVDLWVEALHSLGHDPVPAAACAFSARFDGAQWTFLKFRPEDLLALYGIDVAEMNVWRRPVDH 93  Rhodo...
Q0S4K0                  14 EPHSIHSDERTWTETNCYLDLWVEVLHSLGLDPVPAAACAFGARFDGSQWTFLKFKPEDLFALYGIDVGEMNVWRRVLDH 93  Rhodo...
CBS91304                11 DRHPLHQGERIWLETNCYVDLWIEALHARGLDPLAMLGFTVTQDFEGDQFTFFKVPLEDLETLYGLRVQELAIYDSVETH 90  Azosp...
jgi:Mrad2831_0187       18 VPHPLHDSGRDWPETNCYVDLWIELLHGRGLVPEAMLGFTLRQDFEGDQFTFFKPPTGDIERLYGLEVLELAVYGGLENH 97  Methy...
WP_012654279            13 TPHLLHSAERMWPETNCYVDLWIEVLCVLGLPPEAMLGFTLTQDFEGDQFTFFKVPLEDLEALYGIRVTELAIFDRAEAH 92  Agrob...
WP_012091531            14 TPHALHAQTRIWPETNCYVDLWIEVLATLGVAPEAMLGFTLTQDFEGDQFTFFKVPLEDLEALYGVRATELAIFDHVESH 93  Ochro...
Q2K2Z6                  14 RQHALHSGERAWPETNCYVDLWIEVLATSGAAPEAMLGFTLAQDFEGDQFTFFKVPLEDLEALYGIRATELAIYDRVECH 93  Rhizo...
WP_012652840            14 QPHALHDSERMWPETNCYIDLWIEVLASLKLPPEAMLGFTMGQDFEGDQFTFFKVPLEDLEALYGIRCTELAIYDKVERH 93  Agrob...
BAG30385               119 LQLAMSR---GDALVVEVDAFHLPDTEGvSYGLEHTKTSIVPLRLDPLAGELVYLHNDGVHVLGGEDLEHTLGP-AMRGG 194 Kocur...
jgi:Gbro_1075          102 VCSGPQR---GLLHTVEVDSWWLPDTAGtDYRTGHVKTTIVPVAVDRDARSLTYVHNAGVYELSGEDFAGLF------AP 172 Gordo...
PRJNA231235:Y013_13430  94 LEGNAAA---GLLSTIEVDAFWLPDTEGtGYRESRSKTTIVPNLIDRDSGTLEYFHNSGYHVLTGEDFRGVFGL-D-EPV 168 Rhodo...
Q0S4K0                  94 VEDNLAA---GMLSTVEVDAHWLPDTVGtGYRESHTKTTIVANYIDREAGALEYFHNSGYHRLAGDDFRGLFGL-DVAGS 169 Rhodo...
CBS91304                91 VAEQLNRdpdGGLVLVEVDGFHLPDTRGtSYGTTHVKTTVGIVRIDPAARTMDYFHNAGFHRLDGADYEGV----ATAAA 166 Azosp...
jgi:Mrad2831_0187       98 AEIQAAA---GRPVLVEVDAIYLPDTQGtTYGREHGKTTIGILALDPAARELDYLHNAGRFRLSGDDYGGIF------GP 168 Methy...
WP_012654279            93 VAQQISR---GRLCLVEMDSYFMPDTAGvGYRQHHGKTTVGVNRLDLAGRSMDYFHNGGFFRLEAEDFDGIWQL-AAPET 168 Agrob...
WP_012091531            94 VAEQIAR---GRLCMIEMDSYFMPDTHGvSYRTEHGKTTIAINRMDVENRLLDYFHNGGFYHLEGEDFDGVFQRhLTEAD 170 Ochro...
Q2K2Z6                  94 VEVQIAR---GRLCLIEMDSFYMPDTRGtAYRQEHGKTTVAINRLDVTAKRVEYFHNAGYFQLEGEDFDGLFQLqLTESD 170 Rhizo...
WP_012652840            94 VAEQIGR---GRLCLVEMDSFYMPDTQGvGYRREHGKTTVAINRLNLAGRELDYFHNGGFFQLSGEDFDGLFQLhLTDED 170 Agrob...
BAG30385               195 SVPYPYVELVRLDGmRRLSEQELWWRGVGLVRAHLRRAPSDSPARRLVDSIRAQLPVLAERGLPYFHVYSFATTRQAGLT 274 Kocur...
jgi:Gbro_1075          173 PELPPYVEQIRRVG-PDPGNRVDPDLIRAVARRHLDRRPPGNPAARLADSVRDALSWLPDADMTTFHLWSFATLRQCGAT 251 Gordo...
PRJNA231235:Y013_13430 169 PTWPPYLEQVRLD-----AAQPQCDAFDTVVLRHLRMRAGSNPVRELGERVLADIDPIRTGGMDVFHPWTFGVLRQCGAT 243 Rhodo...
Q0S4K0                 170 VTFTPYVEQVRFDG----DPGYRPARFEAVLRHHLATRPDGNPVRELGERVVADVPWIRDAGIDTFHLWTFGVLRQCGAT 245 Rhodo...
CBS91304               167 GPLFPYVEFVKPAQ-PALEGRALRDASLALLRRHLARRPAENPIAAYRAAFPEHLERLLSRPMEYFHLYAFNLLRQLGAN 245 Azosp...
jgi:Mrad2831_0187      169 ATLPPYAEFVKTVA-PPLGTAELPTVARELLVRHRARAPRRNPVLAFRDALAATAGDLVVRPLSVFHAYAFNTTRQLGAN 247 Methy...
WP_012654279           169 APFLPYTEFAKFPE-TRPDETHLRAVAKRLFAFHFARRPQGNPFAGFAEVFPAQVEAIAERPFGYFHTYAFNTLRQFGAN 247 Agrob...
WP_012091531           171 LPFLPYTEFAKFPK-HVPDEAHQRRVAEILLPRHFVRRPKENPIRAFASVFPGQVEAIAERPFGFFHKYAFNTLRQLGAN 249 Ochro...
Q2K2Z6                 171 PPFLPYTEFARFPE-KPADEAHLRATARRLAAFHFTRRPRENPIRAFAAVFPQQVEAVADRPFGFFHKYAFNTLRQVGAN 249 Rhizo...
WP_012652840           171 LPFLPYTEFAKFPE-IKPGEAAIRQTSRQLLAFHFRRRPVANPIRSFAAVFPAQVEALAERPFGFFHKYAFNTLRQVGAN 249 Agrob...
BAG30385               275 AGLAAHVCRFLAdgAQAwpsdlcPERLREAAEAFDDAAGAAKTLQFQLARA-ASGRTPRVDASSAAFVAGYDAATKAVR 352 Kocuri...
jgi:Gbro_1075          252 AEVAADLADLLA--RDG------LD-TTPAAERLRAVALTAKTVQFKMARA-ARGRAVDLDDLLSALTSDWLAGIDLLD 320 Gordon...
PRJNA231235:Y013_13430 244 AELAADVSVYMD--GRG------YPGAAAAADGFRAVAEGAKSVQFRMARA-ARGRNVDPGDQLIAMAAAWEDAMATVV 313 Rhodoc...
Q0S4K0                 246 AELAADVCEYLE--RNG------FAGAAAFAPGFRAVAQGAKSVQFQMARA-ARGRSVDPSAQLDGMAEAWERSVGGVA 315 Rhodoc...
CBS91304               246 FELLGAHVRWL-------------DGPAEAEEACRIISQGAKAMQFQLARTvARRKAPDLSDGFDRMERAYDTALGALA 311 Azospi...
jgi:Mrad2831_0187      248 FEMLASHLTWLE--DRK------AGGFAPAAAAAADLSREAKAFQFQLARAfHRRSADGLAPRLDRLAATYDRVFADLD 318 Methyl...
WP_012654279           248 FELLASHLKWLA--AD--------DRYTNEIAEALRISELAKTVQFQLARAvTRKKFDPLKAALDPAIDAWDRLMTGLA 316 Agroba...
WP_012091531           250 FELTASHLDWLG--QG--------RRFATASADALQIAETAKAVQFQLARAvMRKKFDALAGTLQPAADAWDRMTTALA 318 Ochrob...
Q2K2Z6                 250 FELAADHLAWLS--PD--------E-FAAAAEHARRISDVAKSVQFQLARAvARRKFEPLQAALDPAADAWDSMMASLA 317 Rhizob...
WP_012652840           250 FELAGSHLDWLS--AD----------FAEVAAQARRISEVAKSVQFQLARAiTRKKFEPLQTALDPAADAWDSMMGLLE 316 Agroba...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap