6ITW


Conserved Protein Domain Family
GAD-like

?
pfam08887: GAD-like 
Click on image for an interactive view with Cn3D
GAD-like domain
This domain is functionally uncharacterized, but it appears to be distantly related to the GAD domain pfam02938.
Statistics
?
PSSM-Id: 400997
View PSSM: pfam08887
Aligned: 10 rows
Threshold Bit Score: 130.962
Threshold Setting Gi: 75382237
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ITW_A         8 YENALKRFG-----LPENP-EIXGEADIARYKNRIPETYLDFIRHAGLGIWKQGYFQFCNPEKYKSIVALALGGDK---Q 78  Agrobacterium f...
Q88PR4         5 FSLFVEQVG-----EPFFR-QEVPPSSLDRYRGILPNKLLAYWSEHGWCGYGDGIFWTVNPQEYEGVTASLIEGTI---L 75  Pseudomonas put...
Q88F70         5 FSIFLDNIG-----APFSR-REVPPSSIDRYNGKPPELLLAYWKEHGWCGFGEGIFWLVNPQEYEGVVSSWTEGTL---L 75  Pseudomonas put...
Q88PR6         5 LASLIENFG-----PPIDR-REVPGSTIERYRDKLPPKLLEYWSEHGWGGYGEGILWLVNPQEYDAVVSCWIAGTA---L 75  Pseudomonas put...
Q887W6         1 ----mETFG-----GQVGR-QEVPESSIDRYRGKLPNQLLTYWAEHGWCGYGDGIFWTVNPQEYDAVVASWLEGTK---F 67  Pseudomonas syr...
Q88F69         5 FSIFLETFG-----DPIGQ-QPVPPAAVDHYQGKLPNRLLEYWQDHGWCGYGGGLFWLVNPQEYQGVVASWLAGTH---F 75  Pseudomonas put...
WP_014845423  17 LQKFFEDEG-----GPLGVgETASPEVLEYFEGILPASTLQIWRTIGFDGLAGGRHWITNPLEWAPAVDSWLEGMEl--P 89  Pseudopropionib...
Q7CSZ3        17 IEELLNAYEidhivKPSA-------QIVERYKDRLPEILVKFWIEKGWCSWSKGQYWICDPSIFQPVIDYVFLGDS---E 86  Agrobacterium f...
WP_013124941   6 FELFLRDVP-----LTTAG-PACTQQHLDTYRGVLPNPLLSYWQEYGFSGFGDGIVWLTDPLEWQATTTLITAGIThrpL 79  Tsukamurella pa...
Q883B0         6 FEIFVDAMG-----EPVKV-CPASESVIDKYKGVLPDVLLDYWRSEGWCGYADGLFWTVNPDEYKHLLDMWLSGTK---F 76  Pseudomonas syr...
6ITW_A        79 LNPVRTHALGFSAFGKILAWNEDY-KTTEIN 108 Agrobacterium fabrum str. C58
Q88PR4        76 EKRDRYHLIARGAFGDLYLFGEQTgFSVKIL 106 Pseudomonas putida KT2440
Q88F70        76 ENRDTYHLIARSAFGDLYLWGENSgFSVKIT 106 Pseudomonas putida KT2440
Q88PR6        76 ASHDSYHLVARSAFGDLYLWGEKTrFSLEIT 106 Pseudomonas putida KT2440
Q887W6        68 ETFDAYHLIARSAFGDLYLWGEEIgASLKIT 98  Pseudomonas syringae pv. tomato
Q88F69        76 EACDTYHLIARSAFGDLYLWGEKTgSVLTIA 106 Pseudomonas putida KT2440
WP_014845423  90 FPPQRWWCVTRTPMGSMQLWGEVSgPALavk 120 Pseudopropionibacterium propionicum
Q7CSZ3        87 LDPTRMVAFGYNAFGNVDIWYGD--ATIRLN 115 Agrobacterium fabrum str. C58
WP_013124941  80 GTDATYIPILRTAFGKIWFWTPGFgRSLTIT 110 Tsukamurella paurometabola
Q883B0        77 SGIDNYHVIARSAFGDLYAWGEKYgRKIIVS 107 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap