5L9W,5M45


Conserved Protein Domain Family
Acetone_carb_G

?
pfam08882: Acetone_carb_G 
Click on image for an interactive view with Cn3D
Acetone carboxylase gamma subunit
Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalyzing the condensation of acetone and CO(2) to form acetoacetate.
Statistics
?
PSSM-Id: 400992
View PSSM: pfam08882
Aligned: 30 rows
Threshold Bit Score: 145.55
Threshold Setting Gi: 1132604559
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5L9W_C          5 IRFTEYLDLDLND---------EHWYCHD-CGTKLISARESYKKGCLVAERRPHEIHNPVi---eGEYSFAPDENWVRIL 71  Aromatoleum ar...
jgi:Plav_1150   3 VFITAALTIDLGK---------ERWECAA-CGHDLGSARENYKKGLLVRDRAPEEIHAPIldparYEFTFAPDGDWCRIL 72  Parvibaculum l...
jgi:Xaut_1339   3 VAMTEYLRINLKS---------ERWECRV-CDHDIAPARGNYKEGLLVHDRDPREIHPPIldpdkYRFTFSPDPEWVRIL 72  Xanthobacter a...
jgi:Pnap_1164   3 VLMTEYLRLDLDA---------EQWECRV-CDHSIGSATKGYKEGLLVYNRDPREIHPPIidpeqYRFTFSPDPEWVRIL 72  Polaromonas na...
WP_023985459    3 VPMTEYLVIDLDT---------ERWVCRV-CAHDIGSAHENYKPGTLVYDRDPREIHQPIidpdrYEYTFSPDPAYCRIL 72  Mycobacteriaceae
Q4FRR0          3 VPMTEYLLIDLES---------ERWVCRV-CEHDFGDARGTYKEGTLIYDRNPEEIHPPVidpkrYKFTFSPDPSYCRIY 72  Psychrobacter ...
Q0RWI2          3 VPMTEYLTIDLAT---------EQWVCRV-CDHELGSARGNYKEGTLVYDRDPREIHQAIidpdkYEFTFAPDPNYCRIL 72  Rhodococcus jo...
WP_013677933    5 IHVAEYLDLDVDS---------ERWHCHS-CGHDVGDARDNYKKGLLIYERDPSEVHPPLi---dGEFTFAPNPEWIRIL 71  Pseudonocardia...
Q1AUX4          4 IRVTEYLDLDLGD---------ESWYCHV-CGYGFGSARGNYKEGCLIHERDPREVHRPIi---eGEYTFAPDPEWVRIV 70  Rubrobacter xy...
O25404         48 VDFDDKIVLPLGPhlfvvqdaqKKWVIKCsCGHAFCAPEENWKLHANIYVRDTAEKMEEV-----YPKLLASDTHWQVYR 122 Helicobacter p...
5L9W_C         72 EFYCPGCTRQIETEYLPPGHPITVDIEVDIDSLKARLK 109 Aromatoleum aromaticum EbN1
jgi:Plav_1150  73 EYCCPSCGRLAEVEYLPPGHPPAHDIELDIDALKAQWA 110 Parvibaculum lavamentivorans DS-1
jgi:Xaut_1339  73 EYCCPSCGTQVETEYAVPGHPPLHDMEVDLDALKAQWA 110 Xanthobacter autotrophicus Py2
jgi:Pnap_1164  73 EYYCPHCGTMVETEYAIPGHPPLHDMEPSLPAMREQWA 110 Polaromonas naphthalenivorans CJ2
WP_023985459   73 EYYCPGCGTQIECEYLPPGHPPAVDILIDIPALRAQWA 110 Mycobacteriaceae
Q4FRR0         73 EYYCPGCGTQIETEYLPPGHPPTIDMLWDIDDLRRRWE 110 Psychrobacter arcticus
Q0RWI2         73 EFYCPGCGTQMETEYVPPGHPPTVDMIWDIDSLRAKWL 110 Rhodococcus jostii RHA1
WP_013677933   72 EFYCPGCGRQVETEYLPPGHPITHDTEIDLDSLKRKLA 109 Pseudonocardia dioxanivorans
Q1AUX4         71 EFYCPGCGTQIETEYLPPGHPITHDIEIDIDRLQQRIA 108 Rubrobacter xylanophilus DSM 9941
O25404        123 EYICPDCGILLDVEAPTPWYPVIHDFEPDIEVFYKDWL 160 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap