6LTH,6UXV


Conserved Protein Domain Family
QLQ

?
pfam08880: QLQ 
QLQ
The QLQ domain is named after the conserved Gln, Leu, Gln motif. The QLQ domain is found at the N-terminus of SWI2/SNF2 protein, which has been shown to be involved in protein-protein interactions. This domain has thus been postulated to be involved in mediating protein interactions.
Statistics
?
PSSM-Id: 400990
View PSSM: pfam08880
Aligned: 118 rows
Threshold Bit Score: 35.3922
Threshold Setting Gi: 475666170
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6LTH_I        171 PFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQ 205 
KRH77798       13 PFTMSQWQELEHQALIYKYMVAGLPVPPDLVLPIQ 47   soybean
Q6AWY8         18 PFTASQWQELEHQALIYKYMASGTPIPSDLILPLR 52   Japanese rice
AOG30085       14 LFTASQWRELEHQALIYKYMAAGSQVPHELVLPLR 48   bread wheat
XP_009408738   57 PFTASQWQELELQALIFKYMVSGIPVPPDLILCIR 91   wild Malaysian banana
EEF40997       12 PFTPSQWQELEHQALIYKYMVSGIPIPPELIFTVK 46   castor bean
KRH06182       13 PFTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIK 47   soybean
CBI27820        9 PFTATQWQELEHQALIFKYMASGMPIPPDLIFSIK 43   wine grape
EEE65284       10 LFTATQWQELEHQALIYKYMAAGAPVPPDLLLHLR 44   Japanese rice
RZR72784        8 PFTVAQWQELEHQALIYKYLMAGVPVPPELVIPIQ 42   Ensete ventricosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap