3D7Q


Conserved Protein Domain Family
XisI

?
pfam08869: XisI 
Click on image for an interactive view with Cn3D
XisI protein
The fdxN element, along with two other DNA elements, is excised from the chromosome during heterocyst differentiation in cyanobacteria. The xisH as well as the xisF and xisI genes are required.
Statistics
?
PSSM-Id: 400985
View PSSM: pfam08869
Aligned: 130 rows
Threshold Bit Score: 100.592
Threshold Setting Gi: 504987705
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3D7Q_A             3 DKL-NEYRTKVRQLLTKHLQYKPS-YGDVEVEQIFDEEHDHYQIISVGWNNQHR-IYGPIXHLDIKNNKIWIQQNTTEAD 79  Nostoc punc...
jgi:Haur_5179      2 DST-PTYRMILQAVLTDYHTRTKDaDPTLERQLILDPVHDHYMLMAVGWQGPRR-IAHCLIHCDLKDGQVWIQTDSTEPG 79  Herpetosiph...
jgi:Mic7113_1646   2 DTS-TRERDIVKQVIQRYAQFKPS-HGHIRLDTVFDDTQNRYALMQVGWDRGRR-VRGNLIYVTLSEGKVWVEYDGMEQG 78  Microcoleus...
WP_015174807       2 DNS-LSYADILKKTLQEATIAQPR-LQAIQLYPVCDVDSGHFLILATGWDKQ-RwIDTILFHARLVDNQVVIEEDNFEEG 78  Oscillatori...
WP_012268251       2 DTR-LKYQGIIKTVLQNHANYRATlPDGYTSQVIFDDERGHYLVLDFGWSGNKY-LHATPIHLSLVVDKVWIQCDETEEG 79  Microcystis...
WP_012267885       3 slI-AQYRQIIEKTFQDYADFLDT-DRQIQIELVLDQTRDRYLLVETGWQNGYR-IYGTLLHIDIIDQKIWIQHDGTEDG 79  Microcystis...
jgi:Anacy_4344     4 LTI--QYRQIIQKILEEYADFLGN-DEQVKVELVLDENNDRYLLVETGWENGYR-IYGTLLHLDLIDGKVWIQHDGTEEG 79  Anabaena cy...
jgi:Riv7116_5242   2 DSLnSNYPDIIEKVLRDYAEFLGD-DDNIQIELVFDRERNRYLLVEAGWQNGYR-IYGTLIHIDIIDNKLWIQHDGTEEG 79  Rivularia s...
WP_015168721       3 fpL-TNFQIAIQKVFNDYINFLGE-TEDIHLEAVIDKDHDRYLLIELGWENGRR-IYGTLIHIDIINNKLWIQQDGTEAG 79  Synechococc...
WP_009546556       2 DNStLNYQDIIEEILNEYIDYLGE-DEQVEIKLICDSNKGHYLLTEIGWSNGYR-LYGTLIHIDIIDDKLWIQQDGTEEG 79  Crocosphaer...
3D7Q_A            80 IALELXEXGIDKQDIVIGFHTPKXRQ 105 Nostoc punctiforme PCC 73102
jgi:Haur_5179     80 IAEQLVDQGIPKSAIVLAFLAPYKRP 105 Herpetosiphon aurantiacus DSM 785
jgi:Mic7113_1646  79 ITKDLIAAGIPPERIVLAFLPEEQTa 104 Microcoleus sp. PCC 7113
WP_015174807      79 LSQALIAGGIKTEDIVSSPFPDNSDR 104 Oscillatoria nigro-viridis
WP_012268251      80 IATDLMEAGIPKEDIVLGFRYPKVRK 105 Microcystis aeruginosa
WP_012267885      80 IADELVAAGIPQNQIILAFKSPEIRP 105 Microcystis aeruginosa
jgi:Anacy_4344    80 IANDLVAAGIPKSHIILGFKAPEIRK 105 Anabaena cylindrica PCC 7122
jgi:Riv7116_5242  80 VAIDLVAEGISKDKVVLGFRDFEERK 105 Rivularia sp. PCC 7116
WP_015168721      80 IADDLIAFGIPKHQIVLGFKPIERRE 105 Synechococcus sp. PCC 7502
WP_009546556      80 IAEELVKKGISKDRIVLAYKSLQERK 105 Crocosphaera subtropica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap