2IAY


Conserved Protein Domain Family
DUF1831

?
pfam08866: DUF1831 
Click on image for an interactive view with Cn3D
Putative amino acid metabolism
Solution of the structure of the Lactobacillus plantarum protein from this family has indicated a potential new fold with remote similarities to TBP-like (TATA-binding protein) structures. This similarity, in combination with genomic context analysis, leads us to propose an involvement in amino-acid metabolism. The potentially novel fold is an alpha + beta fold comprising two beta sheets packed against a single helix. The enzyme is present in the cytosol.
Statistics
?
PSSM-Id: 400983
View PSSM: pfam08866
Aligned: 30 rows
Threshold Bit Score: 143.109
Threshold Setting Gi: 345504715
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IAY_A          3 AYTTTVKLDGDTkTYTLSPTVKKYTLXDLGFVKGRSGAFSFERSLDPTSPYQAAFKLKXTVNADLTGFKXTTVTGNGVQR 82  Lactobacillus ...
bgi:05SSU1067   6 AFQQSVTLKDCNfTYHISPAIKKYTLRDNTFEQTKAGHYQLTRLLEEIPNSNQGFLLKIIINQDLTGFKINITDKSGLHL 85  Streptococcus ...
BAK61087        2 AFITEKKLEGCKySYTLSPKVKKFTLKDTTFSQNNIGNFEFKRILEEVPNSGQGFLLKIIINPDLTGFKLSVTDKSGLRN 81  Lactococcus ga...
Q9CEI1          2 AFITEKHLEGSKyVYQLAPTVKKFTLKDTTFIQTKIGNFEFKRLLEEVPNSNEGFLLKIIVNPYLSGFKLSVTDKSGLRN 81  Lactococcus la...
Q8CYS0          2 AFEKIIQLKNCRyDYTLSPSVKKFTLKDNTFFETKVGNYELTRLLEKVPNSGEGFQLKIIINKELTGAKINITDKFGLRL 81  Streptococcus ...
Q99ZR2          2 AFEKEIKLKDCKyLYTISPNIKKYTLRDTTFSQTKVGHYQLIRLLEKIPNSGDGFPLKITINKELTGFKLAITDQSGLRL 81  Streptococcus ...
Q8DU92          2 AFEKTIQLPDCKySYTISSKVKKFTLQDTTFMQNKLGNYELNRLLEKVPNSGEGFPLKITINKDLTAFKLTITDKSGLRV 81  Streptococcus ...
Q5M3G2          2 AFEKSIHLADCKyRYTISSNVKKFTLRDTTFVQNKIGNYELHRLLEKVPNSGEGFPLKITINKDLSGFKLSITDKSGLRN 81  Streptococcus ...
Q832Z7          2 AFTTTAAVEGSTvFYKVHPSAKRYTLKDNGFTETKSGNFQLIRSLDPTPQRNEGFKLKITITADLKELKMSITTANGLKP 81  Enterococcus f...
BAK21328        2 TFAKTATIEGGTtTYTLHPQIKRYTLKDNGFVETPSRNFQFIRSLEATPQNRDGFKLKIVISKDLKTLKMSVTTANGLKA 81  Melissococcus ...
2IAY_A         83 ANIFKNDAHPEAVEQLRYILANFIERDILT 112 Lactobacillus plantarum
bgi:05SSU1067  86 VNIFKPESNKVIQEKFYFLMDSLIDRDIFT 115 Streptococcus suis 05ZYH33
BAK61087       82 VNIFKNAS-EIIQEKFYFQMDTFVDREIFI 110 Lactococcus garvieae Lg2
Q9CEI1         82 VDIFKNAS-EMIQNKFYFQMDALVDRGVFT 110 Lactococcus lactis subsp. lactis
Q8CYS0         82 VDIFKSEDHHIHQEKFYFLMDSLVERGVFT 111 Streptococcus pneumoniae R6
Q99ZR2         82 VNIFKTKDNQILQDKFYFLMDSLVEREIFS 111 Streptococcus pyogenes serotype M1
Q8DU92         82 VNIFKSEENHIIQDKFYFLMDSLVERDIFE 111 Streptococcus mutans
Q5M3G2         82 INIFKNEDHHILQEKFYFLMQSLVDRQVFE 111 Streptococcus thermophilus LMG 18311
Q832Z7         82 MNIFKNEQHEMSKEKYFFLMDGLISRGVLE 111 Enterococcus faecalis
BAK21328       82 VNIFKNDQHKASQEKLNFLIETLMNNHILV 111 Melissococcus plutonius ATCC 35311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap