Conserved Protein Domain Family
YolD

?
pfam08863: YolD 
YolD-like protein
Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily.
Statistics
?
PSSM-Id: 400980
View PSSM: pfam08863
Aligned: 42 rows
Threshold Bit Score: 71.8285
Threshold Setting Gi: 503172163
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5WIB2        29 MLPEHKQAWIEMQKDENKVElHGELDDDQWRAIGKVVMDALNHTLVVRLTYWQDGYYIDKDCYIYKVDELNKRVRIEYGP 108 Bacillus clausi...
P54561        18 FLPEHKQSLLERKRLKQKLQ-KPILDPDKLEEMNQTLCAAMEFAQDITVSCFQDGEIVCCTGKICRYEEFEKAVWIKGDE 96  Bacillus subtil...
WP_012959033  13 AIPEHMEMIRTEREKRNLPQ-KPELDPQAMEELMYIIEEKIALQQPAKVTYWQLHEAHVVEGFVKKPSSSRKVIDIIEAG 91  Bacillus pseudo...
ABV62772      20 MLPEHREQLLAQKRKKKEYT-PPPLSTDQLEEMNFLITQSITEDQAICVTYAAAGRKEQFWGWVKTIHYETQRIKIVNDE 98  Bacillus pumilu...
BAH18372      43 TMPEQFLDVKRQIDAQTKIE-RPELSEDRLQEINEVLHSALSKQQPVYIDYYIDGTIQHTKMYIEKVDQWAAIIIGTTVN 121 Macrococcus cas...
Q2FWX7        36 TLPEQFETIQQYIIDQNKIT-RPVLSDDQLAELNIRLHEALQYAQPVEVKFYNNGFVDSVRLTIYRIDAINYEIDGYVYN 114 Staphylococcus ...
Q81E46        22 SIPEQYEEIHRMFEEQYKVP-KPFLTQDTMERIERALMQSFHEEEEIHISYYRDGMVQDMYINVLHIEPMTKTIYCTDAF 100 Bacillus cereus...
Q81DS8        18 VMSEQLLNMRKIIGEKLKVQ-KPLLTNEAKERISDKLLTSLLSEKEILVTYFEDGYILTSYMTVVHINPVKQIVICTDAF 96  Bacillus cereus...
Q9RMW4        20 ALTSQFDGIREIIKEQNKVT-RPILTTAEKERIENILLCSLLSEEEILITYYEDGYLLSGYMTVVDIDPLNSAVICTDAF 98  Bacillus anthracis
Q5HMT7        40 TIPEQFEKLKEYIIDQNKTD-RSSLSSAQFEYINNKLNYCYKNHAPITIYYWNNGYISNLYCYIKAVDLTEKHLIVSNEN 118 Staphylococcus ...
Q5WIB2       109 SDDStreWIDMRVIYDVQ 126 Bacillus clausii KSM-K16
P54561        97 DQLY---KLKLDQVLDIV 111 Bacillus subtilis subsp. subtilis str. 168
WP_012959033  92 GGRK---RVEQINILKIE 106 Bacillus pseudofirmus
ABV62772      99 DVL----NLSLQQIVAID 112 Bacillus pumilus SAFR-032
BAH18372     122 EGHTy--FVSFLDIVNLE 137 Macrococcus caseolyticus JCSC5402
Q2FWX7       115 QQQRq--KISIFDILDIV 130 Staphylococcus aureus subsp. aureus NCTC 8325
Q81E46       101 GLNT---KFKFDELVNIN 115 Bacillus cereus ATCC 14579
Q81DS8        97 YKTY---VFNAMDIIEIM 111 Bacillus cereus ATCC 14579
Q9RMW4        99 YNTM---KLQFSNIIDVK 113 Bacillus anthracis
Q5HMT7       119 GNQTr--RISFKNVCDVD 134 Staphylococcus epidermidis RP62A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap