Conserved Protein Domain Family
DUF1820

?
pfam08850: DUF1820 
Domain of unknown function (DUF1820)
This family includes small functionally uncharacterized proteins around 100 amino acids in length.
Statistics
?
PSSM-Id: 400969
View PSSM: pfam08850
Aligned: 30 rows
Threshold Bit Score: 143.539
Threshold Setting Gi: 146232926
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0VN99          6 PIYRVIFQSQAQTYEIYASEIYQSDLHGFIEVEEFLFDERSGVVVDPSEEKLKSEFSGVLRSYIPMHTVIRIDEVEKEGV 85  Alcanivorax bo...
Q2SBF5          8 KVFRVVYFNQDEVFELYASKVYSSELYGFIEVENWLFGERSQLLVDPAEEKLKGEFAGVSRSFIPMTSIIRIDEVEQQGT 87  Hahella chejue...
WP_015485995    9 PTYRIIFQQQGDIFEIYASYIYQSELYGFIEVEQLLFGEGAQGELDSEEEKLKETFADVKRTFIPMNSIIRIDEVEKEGT 88  Thalassolituus...
Q21FH5          5 PIYKVIFHNLDQVYEIYARAIYQSEMYGFVEVEEFVFGERTQLVVDPGEEKLKGEFAGVKRSFIPMHSIIRIDEVEKEGV 84  Saccharophagus...
WP_015048746    5 PTYKVIFYNQNQVYEIFCRAIYQSEMYGFIEVEEFVFGERSAMIVDPGEEKLKGEFAKVKRSYIPMHSIIRIDEVEKEGA 84  Simiduia agari...
WP_012487267    5 PVYKVIFLNQGQVYEVFCSAIYQSEMYGFIEIEEFVFGERSQLLVDPAEEKLKNEFAGVKRSYIPMHSIVRIDEVEKEGP 84  Cellvibrio jap...
tigr:DNO_1328   7 VIYRIQFKTDENDFDIYVRNVYPSDMNGFICIEGFLFREETSSIINPKVERLLHEFHHVETAFIPYYQISRIDAVSQAGE 86  Dichelobacter ...
WP_025385783    5 MLYRITFSYLDAIYEIYARKVCESDMFGFLEVEDFVFGETTSLVVDPSEERLKVEFNGVQRTFIPMHSVFRIDEVNKKGT 84  Legionella
CBJ11961        5 TIFKITFANQEAIYEIYARSIKESDMFGFLEVEELVFGEQTSLVVDPSEERLKIEFNGVKRTFIPMHSIYRIDEVTKQGT 84  Legionella lon...
Q83CN3          6 RIYRIIFSQDEKIYEIYARYISEENLMGFIELEDLLFSEGNSVVVDPSEEKLKTEFQGVKRSYIPMHMILRIDEMEKEGA 85  Coxiella burnetii
Q0VN99         86 GKITESRgEarSNNVSPFPM 105 Alcanivorax borkumensis SK2
Q2SBF5         88 AKISSGK-S--GGTVASFPR 104 Hahella chejuensis KCTC 2396
WP_015485995   89 PKVSKGD----GSNVTPFPV 104 Thalassolituus oleivorans
Q21FH5         85 VKVLEVK----GDKVAQFPY 100 Saccharophagus degradans 2-40
WP_015048746   85 AKVVELK-S--GEKVTQFPL 101 Simiduia agarivorans
WP_012487267   85 AKISEIKgG--SDKIAQFPY 102 Cellvibrio japonicus
tigr:DNO_1328  87 SKIKARTn---ASKVTPF-L 102 Dichelobacter nodosus VCS1703A
WP_025385783   85 AKVRDKAsD--SSKISMFPI 102 Legionella
CBJ11961       85 AKVKDNPgY--GSKVSPFPg 102 Legionella longbeachae NSW150
Q83CN3         86 AKIKGLTp---KGNVHHLPS 102 Coxiella burnetii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap