Conserved Protein Domain Family
Crr6

?
pfam08847: Crr6 
Chlororespiratory reduction 6
Chlororespiratory reduction 6 (Crr6) is a factor required for the assembly or stabilisation of the chloroplast NAD(P)H dehydrogenase complex in Arabidopsis.
Statistics
?
PSSM-Id: 400966
View PSSM: pfam08847
Aligned: 44 rows
Threshold Bit Score: 200.505
Threshold Setting Gi: 504920607
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015166679   7 VNADCIAQIDIAPARVVVDKLL-ATIATTngaiatlpeDQAIKFNIMFPQE-PTDPRELSEIPEIRLWFIRLDAVYPWLP 84  Pseudanabaena s...
WP_011935993   9 VSADQIRCLDMSPLQELRQRPA-TALLEL---------EDGLALQLEWPRA-DDDPRELSEVPECRLWSLRADALCPWLT 77  Synechococcus s...
WP_015107709  16 VSGAQVRALDLSPLAGLASLAP-AALLSA---------ASGLTLDFGWPRE-AEDPRELSEIPELRLWSLRADALHPWLP 84  Cyanobium gracile
Q31P83         7 LPADAIAQLDLSPVQTALPELKtADWLTL---------EQQVCLKIQWPRS-EDDPRELAEIPEIRLWFIRLDATYPQFP 76  Synechococcus e...
Q2JPC6         7 LPAKAIQTLDLTPGHELVKTLM-ADPVRA---------AQQVQCAIDWPRS-PEDPRELSEIPEVRLWFIRWDTVYPWMP 75  Synechococcus s...
WP_023172758   7 LDQPAIDRLDLRAAGVQIERLA-ADPLAN---------ARQLRFEIDYPRA-ADDPRELPEVQEIRLFFIRLDARYPWLP 75  Gloeobacter kil...
EFJ30720      16 IDKETVRRLDLSPAHALLrndp------------nellQKTVGFVINYERDdPVDPRELSELPDLRLWFLRLDAAYPWLP 83  Selaginella moe...
ERN05473      69 LDNDILRRLDLSPVCSLM-----GESTQAidpk--ellQRTVGFTINYEREdSSDPRELSEFPEIRLWFVRLDASLPWLP 141 Amborella trich...
XP_015695506  82 INNDIIRTLDLSPVQEVL-----GDSDSLtpaqaknllDRTVGFTINYEREdPYDVRELSELPDIRLWFVRLDACYPWFP 156 malo sina
XP_009407363  85 INKDIIRRLDLSPVEAIA-----GKISSLcaep-rkllDQTVGFTINYERDdPYDTRELSEFPDVRLWFVRLDAAYPWFP 158 wild Malaysian ...
WP_015166679  85 YYLDWREGELTRYAAMLVPHEFKKAEGIEFNVEAIQIFVMQKVFMIHDWLGQQGSSN-TAKLKQMSQALGYEIDAEFFE 162 Pseudanabaena sp...
WP_011935993  78 LLLQRSDGQLSRHVAMQVLHEFSRTEGLRFDPDDLSLWISHRLFWLDEWGNQHGLAL-RGRLGQMAAVLGFNVEAGFWP 155 Synechococcus sp...
WP_015107709  85 LVLERSGGQLTRHVAMLLPHGFSPTEGIRFAPESLELWITQRLFLLDHWAATGGIEC-RANLGQMAAVLGYELDPGFWS 162 Cyanobium gracile
Q31P83        77 LLVNWQSGELVRYAAMLVPHQFSRNEGLQFNPEALAIWVNHKIFYFAQQLADRGLSG-SSRLKNFAQILGFEIDESFFE 154 Synechococcus el...
Q2JPC6        76 YFLNWRQGELARYAAMMVPHQFNPREGIVYNPEALEIFVYQKIFVLMRWFKQQNLGS-VSMLRDMALVFGFEIQPEFLA 153 Synechococcus sp...
WP_023172758  76 YLLDWRNGELTRFAAMLVPHQFSAKDGITFAPEAMEIFVMHKIFVLADWLLAQGITN-RSELRYLAQALGYDIDAEFFD 153 Gloeobacter kila...
EFJ30720      84 VVLDWRSGELARYTAMLVPHQMSQRLGIVYNPEAQELFAMSKLFTVYSWLKARGVANpQAKTNAMMQVIGFGISDELFK 162 Selaginella moel...
ERN05473     142 VVLDWRAGELARYTAMLVPHQMSLRLGVVFNPEALELFVMKKVFIVYSWLKHHNIPKpKLKTSDMARMLGFGIGDELYD 220 Amborella tricho...
XP_015695506 157 VVLDWRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVHSWLKQQNHPKpALKTADMARMLGFGIGDELFD 235 malo sina
XP_009407363 159 VVLDWRAGELARYAAMLVPHQISMRLGIVFNPEALELFVLNKAFTVYSWLKQQKFPKpKLKTRDMARMLGFGLEDSLFD 237 wild Malaysian b...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap