Conserved Protein Domain Family
DUF1816

?
pfam08846: DUF1816 
Domain of unknown function (DUF1816)
Crocosphaera watsonii CpcD is associated with the pfam01383 domain suggesting this presumed domain could have a role in phycobilisomes.
Statistics
?
PSSM-Id: 400965
View PSSM: pfam08846
Aligned: 70 rows
Threshold Bit Score: 89.1164
Threshold Setting Gi: 500468910
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015193696      18 KKTRLPWWVIIQTTIPYCTYYFGPFNNAKEAQLSQYGYLEDLMEEKAHGISVQIKQSRpPQSLTL 82  Stanieria cyanosphaera
WP_015220851      10 DFFGLACWLEITTNHPECIYYFGPFLSQREAQSYSQGYIEDLKGENAVGIITKFKRCK-PKTLTI 73  Cyanobacterium aponinum
WP_014277194      10 NTFGLAFWVEIMTEMPRCTYYFGPFLTENEAEEAEPGYIEDIQGEGATGLQVAVKRCQ-PDILTV 73  Arthrospira platensis
WP_015176624      10 NFFGLAWWVEVKTSAPRCIYYFGPFLTEKEAESAKAGYVEDIENEGAEGVSVSIYRCK-PITLTV 73  Oscillatoria nigro-viridis
WP_015193914      11 DSVGKAYWVEITTDTPACIYYFGPFLTAREAQIAQGGYVEDLKGEGAQGISLTIKRCQ-PSELTI 74  Stanieria cyanosphaera
jgi:Cha6605_5891  67 DFFGQAWWVEVVTNRPRCTYYFGPFADAEAANRAIMGYIQDLENESAQGIQTQIKRCK-PDRLTI 130 Chamaesiphon minutus PCC 6605
WP_013320912      10 TFLGLAYWVEIQTDYPRCIYYFGPFFTKKEADEAKMGYLEDLEHEGAKGISVVSKRCK-PSKLTI 73  Gloeothece verrucosa
WP_015956101      10 TVLGLAYWVEIHTDYPRCTYYFGPFLSKKEAEVSKLGYLEDLDHEGAKGISVTIKRCK-PNSLTI 73  Gloeothece citriformis
WP_002798951      10 EMFGLAYWVEIKTDYPRCTYYFGPFLAKDEAEVAQAGYEEDLKTEGAQGIKLHIKRCK-PEDLTI 73  Microcystis
jgi:GEI7407_3794  10 HTFGLAWWVELKTDTPHCTYYFGPFLTSNEAQRAKSGYIEDLEQEGAQGIAVSIRRCK-PPVLTI 73  Geitlerinema sp. PCC 7407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap