Conserved Protein Domain Family
MHCassoc_trimer

?
pfam08831: MHCassoc_trimer 
Class II MHC-associated invariant chain trimerisation domain
The class II associated invariant chain peptide is required for folding and localization of MHC class II heterodimers. This domain is involved in trimerisation of the ectoderm and interferes with DM/class II binding. The trimeric protein forms a cylindrical shape which is thought to be important for interactions between the invariant chain and class II molecules.
Statistics
?
PSSM-Id: 400954
View PSSM: pfam08831
Aligned: 14 rows
Threshold Bit Score: 86.6955
Threshold Setting Gi: 432878642
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007473939 116 NSTTDQVKYLLQRSDPRRSFPDLTKSFQENLKHLKSNMDPKNWKTFENWMHQWLLFEMSKKPKEE-KTE 183 gray short-tailed opossum
XP_012407251 117 NNTKDQVKYLLLQSDPRRSFPELTKSFQENMKKLKNNMETKNWKNFENWMHQWLLFEMSKKPNEE-NVE 184 Tasmanian devil
ELK17270     120 NSTLDHVMHLLLKSDPLKVYPQLKGSFPENLKRLRNTMEGLDWKAFENWMHQWLLFEMSKNSLEE-KPK 187 black flying fox
P04441       119 NMTQDHVMHLLTRSGPLE-YPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEkKPT 186 house mouse
VFV31726     120 NMTQDHVMHMLLEGDPLKVYPQLKGNFPENLKHLKNTMGTLDWKVFENWMYQWLLFEMSKNSLEK-HPA 187 Spanish lynx
XP_007653534 117 NSTTDQVMHLLLKGAPTKIYPELNEGFQDNMEQLKNNMGHESWQNFKHWMHHWLLFELSKKPQNA-APT 184 platypus
XP_005053523 120 NKTEDQVKHLLLQADPSKMFPELRDNLMDNLKRLRSTMTHADWKSFESWMHKWLLFEMAKNPKSE-DRK 187 Collared flycatcher
XP_015149240 124 NKTEDQIRHLLLKSDPRKTFPDLKDDMLGNLKRLKKTMSAMDWQDFETWMHKWLLFEMAKGPKME-EQN 191 chicken
XP_008103026 112 NSTEDQVKRVLLRENPLRKFPEFNSSFIENIGQMRFRMDYEDWKAFETWMHKWLLFQMAQNAIPE-EKV 179 green anole
KAE8613987   125 NKVEDAAKYMLLRGNPLRKYTLPNGTILENLRELKKSLTDQEWMNFDAWMHQWYLFFLVQNTGKAaepl 193 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap