Conserved Protein Domain Family
DSX_dimer

?
pfam08828: DSX_dimer 
Doublesex dimerization domain
Doublesex (DSX) is a transcription factor that regulates somatic sexual differences in Drosophila. The structure of this domain has revealed a novel dimeric arrangement of ubiquitin-associated folds that has not previously been identified in a transcription factor.
Statistics
?
PSSM-Id: 370143
View PSSM: pfam08828
Aligned: 2 rows
Threshold Bit Score: 134.426
Threshold Setting Gi: 347971137
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAX48940     167 DDELVKRAQWLLEKLGYPWEMMPLMYVILKSADGDVQKAHQRIDEGQAVVNeYSRLHNLN 226 African malaria mosquito
XP_001688199 191 DDELVKRAQWLLEKLGYPWEMMPLMYVILKSADGDVQKAHQRIDEDRLEIH-VNHLQARK 249 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap