1WT6


Conserved Protein Domain Family
DMPK_coil

?
pfam08826: DMPK_coil 
Click on image for an interactive view with Cn3D
DMPK coiled coil domain like
This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerization.
Statistics
?
PSSM-Id: 117396
View PSSM: pfam08826
Aligned: 7 rows
Threshold Bit Score: 57.1565
Threshold Setting Gi: 83753541
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WT6_A     14 ELQEALEEEVLTRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMEL-LQAE 74  
P54265    472 QLQEALEEEVLTRQSLSRELEAIRTANQNFSSQLQEAEVRNRDLEAHVRQLQERMEM-LQAP 532  house mouse
Q5TZ42    875 ELQSALEAEIRAKQLVHDELRKVKAANISFESKLKDTEAKNRELEEQLENMKKEMEE-SRSR 935  zebrafish
Q6DT37    744 ELQSALEAEIRAKQGLQERLTQVQEAQLQAERRLQEAEKQSQALQQELAMLREEL----RAR 801  human
O54874    881 ELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEE-LRSE 941  Norway rat
CAG00138 1025 ELQSALDAEIRAKQSIQDELNKVKAGNIATECKLQDTESKNQELLAEIDRLKKEMEE-LRLR 1085 spotted green pufferfish
Q7TT49    878 ELQSALEAEIRAKQLVHEELRKVKDTSLAFESKLKESEAKNRELLEEMQSLKKRMEEkFRAD 939  Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap