Conserved Protein Domain Family
XisH

?
pfam08814: XisH 
XisH protein
The fdxN element, along with two other DNA elements, is excised from the chromosome during heterocyst differentiation in cyanobacteria. The xisH as well as the xisF and xisI genes are required.
Statistics
?
PSSM-Id: 400941
View PSSM: pfam08814
Aligned: 85 rows
Threshold Bit Score: 180.35
Threshold Setting Gi: 332334748
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Osc7112_6528   1 MPARDTIHNIVKEALIKDGWEITNDPYVISYGE-RFLFVDLAAaasevnnkiEgRFIGAKRENTRIAIEIKEFRGVSPIA 79  Oscillatori...
jgi:PCC7424_5304   1 MAAKDIYHDTVKRALEKDGWTITNDPLTLKIGR-RSAMVDLGA---------E-KLLAAEKEQEKIAVEIKSFLNPSPLN 69  Gloeothece ...
jgi:Osc7112_1714   1 MPAKDLYHNVVKNALIKDGWRITHDPLRLKWGI-KDMYVDLGA---------E-RILSAEKAGQKIAVEVKSFVGASDMN 69  Oscillatori...
jgi:Aazo_4435      1 MPAKDIYHNAVKNGLIKEGWIITNDPLHLKWGQ-KDMYVDLGA---------K-QLLAEEQGTKKIAVEIKSFVSPSEIA 69  'Nostoc azo...
WP_015190863       1 MPNRDRYHEAVKNALIKDGWDITHDPLHLRWGK-RDLYVDLGA---------E-ELLAAERAGRRIAVEIKTFGGLSEIA 69  Gloeocapsa ...
jgi:Mic7113_3552   7 MPARDIYYDAVKNALIKDDWTITHDPLSLKWGK-KDMYVDLGA---------E-QFLAAERAERKIAVEIKSFTGLSEMS 75  Microcoleus...
WP_015168722       1 MPAKDIYHDCVKNALIKSNWDITHDPLRIRLTR-KNLFVDLGA---------E-RLIAANRGSEKIAVEIKSFTQASDIK 69  Synechococc...
WP_015121193       1 MPAKDKYHETVKNALIKDGWTITRDPLRIRLARgRNLFVDLGA---------E-RFLAAEKGVEKIAVEVKSFIGASDMK 70  Rivularia s...
WP_015112256       1 MPAKDIYHDCVKNALIKDGWQITHDPLSLKIGK-KDIFID----------------IAAEKQGTKIAVEIKSFVGISEVE 63  Nostoc sp. ...
jgi:Osc7112_3890   1 MPAKDIYHNTVRTALEKDGWTITNDPLTLEIGD-RSLFVDLGA---------E-KILAAEKQGRKIAVEVKSFLSISPVH 69  Oscillatori...
jgi:Osc7112_6528  80 DLEQALGQYILYRLLLGQVDPERIIYLAVPTLAYNGIFSEPIGELAITEIPLNLVVIDLEKIEV 143 Oscillatoria nigro-viridis ...
jgi:PCC7424_5304  70 DLENAPGQFILYSKILSQNEPDRTLYLAVNRPVFNEIFSEEVGQLLLETTELRLIVFNSKTEEI 133 Gloeothece citriformis PCC ...
jgi:Osc7112_1714  70 DLENALGQYLVYRSVIARTEPDRKLYLAITQSVFSELLSEPLGQIIRADYQVCLIVFAEQNEEI 133 Oscillatoria nigro-viridis ...
jgi:Aazo_4435     70 DLKGAIGGFVLYRALMSRLEPDRILYLGIRDAIFTALFKELIGKLLMESVNVNLPVFNRETERI 133 'Nostoc azollae' 0708
WP_015190863      70 DLQQAVGQYCTYLSVI-RIEPDRTLYLAVQGEVFADIFDEPIGQILLEDYTLSLIVFDSKQEVI 132 Gloeocapsa sp. PCC 7428
jgi:Mic7113_3552  76 DLEKAIGQYIVYHDVLAQVEPDRVLYLAVSEEVARGLFEEPIGELLLRNNRVRLLVFEPDAEAI 139 Microcoleus sp. PCC 7113
WP_015168722      70 DLEDALGQFILYERLLIRYEPDRKLYLAVADAVYKSIFEEEAGQILLEDKLIRLVTFNPKAEVI 133 Synechococcus sp. PCC 7502
WP_015121193      71 DLEQAVGQFILYAPLLKRYYPEYILYLAVSEDTRKRVFEEEAGQTLLEDGIIRLFTFDIIKEEI 134 Rivularia sp. PCC 7116
WP_015112256      64 DLKNTLGQYILYEKILQRLESERIIYLAIRDTVFNKIFTEEIGKILLEENTIKLIVFDSQAEAI 127 Nostoc sp. PCC 7107
jgi:Osc7112_3890  70 DLEEAVGQYIVYEDILELSEPERNIYLAVREEVYLDIFSEPLGQLLLRKKRLKLIVFDSSREII 133 Oscillatoria nigro-viridis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap